PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv7_177580_nrxi.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family LBD
Protein Properties Length: 148aa    MW: 17196.7 Da    PI: 7.9028
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv7_177580_nrxi.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.79.6e-396103198
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaC++lrrkC+kdC++ pyfp+ + ++fa+vhk+FGasn+ k+lk+lpee+r++a++slv eA+ r+rdPvyG+vg+i++l +q+++++
  Bv7_177580_nrxi.t1   6 RCAACRYLRRKCPKDCIFGPYFPSINLERFACVHKIFGASNIAKMLKQLPEERRKEAAESLVQEARSRVRDPVYGSVGTITQLIEQIMEAE 96 
                         6****************************************************************************************** PP

              DUF260  92 aelallk 98 
                          ela+++
  Bv7_177580_nrxi.t1  97 YELAKTQ 103
                         ***9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.2375106IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-386103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MSNSIRCAAC RYLRRKCPKD CIFGPYFPSI NLERFACVHK IFGASNIAKM LKQLPEERRK  60
EAAESLVQEA RSRVRDPVYG SVGTITQLIE QIMEAEYELA KTQGLIALFH AQYLREHQHN  120
YIEPFNKTLT AQIQDDLHFD HFTVESYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-3079912104LOB family transfactor Ramosa2.1
5ly0_B1e-3079912104LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021761801.14e-76LOB domain-containing protein 24-like
SwissprotP594676e-44LBD23_ARATH; LOB domain-containing protein 23
TrEMBLA0A0J8B8811e-107A0A0J8B881_BETVU; Uncharacterized protein
STRINGXP_010278070.13e-48(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.12e-46LOB domain-containing protein 23