PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv7_173170_zfgj.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family M-type_MADS
Protein Properties Length: 227aa    MW: 26151.1 Da    PI: 6.0328
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv7_173170_zfgj.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.21.6e-21250149
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        ++i+nk +rqvtfskRr g+ KKA EL  +C+a+va+i fs+ gkly++
  Bv7_173170_zfgj.t1  2 EPIKNKNKRQVTFSKRRGGLHKKATELRFMCGAQVALITFSPGGKLYTF 50
                        57**********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554554.84E-23169IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-16153IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.077154IPR002100Transcription factor, MADS-box
PfamPF003193.0E-22450IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-91631IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-93152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MEPIKNKNKR QVTFSKRRGG LHKKATELRF MCGAQVALIT FSPGGKLYTF GHPNADVIIH  60
HYMNTINSSN SEEINNYDVK KFGTLSHDQH CYQEVQSDVE RKETKMLANP GFPRGTNYYY  120
NNNNNDDENC GFWWDQSIDD FGLVGLEKFK VALESLRSEV VSKIDTINHR TSMVRRDDPQ  180
KFDFGSVMMD GRSHVAQDFE DFGWNYGMRS DDGLSDDTLL HMLLNDD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010686161.11e-172PREDICTED: agamous-like MADS-box protein AGL62
STRINGXP_010686161.11e-171(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-23AGAMOUS-like 62