PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_154520_fqdr.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family Whirly
Protein Properties Length: 279aa    MW: 31057.1 Da    PI: 9.6917
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_154520_fqdr.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly215.16.9e-671032411139
              Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvr 91 
                         s+yk+kaal+v++++p+f+ ldsg++k++r+G +ll++a+a+++r+ydW++kq+f+ls+ e+++lv+l++k+sceffhdp +++s+eGkvr
  Bv6_154520_fqdr.t1 103 SIYKGKAALTVEPKAPEFVPLDSGAFKISREGYILLQFAPAAGVRQYDWSRKQVFSLSVSEIGSLVSLGAKDSCEFFHDPNKGKSDEGKVR 193
                         7****************************************************************************************** PP

              Whirly  92 kalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                         k+lkvePlpdGsG+f+nlsv+n+l++ +e++++P+skaefavl s+++
  Bv6_154520_fqdr.t1 194 KVLKVEPLPDGSGYFFNLSVQNKLLNLDENVYIPISKAEFAVLLSAFN 241
                         *******************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.109.4E-7896264IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544478.63E-7696273IPR009044ssDNA-binding transcriptional regulator
PfamPF085365.1E-61104238IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MVQQLLSSPS NFSIKTQLPS HGPTSLPYHS LSSRNSFITS TNHFKLTKNW VSHISSSKLL  60
FSVKCRQSSE YFEQSTPRFS PSYSPNPPTS SPGGMPRVFV GHSIYKGKAA LTVEPKAPEF  120
VPLDSGAFKI SREGYILLQF APAAGVRQYD WSRKQVFSLS VSEIGSLVSL GAKDSCEFFH  180
DPNKGKSDEG KVRKVLKVEP LPDGSGYFFN LSVQNKLLNL DENVYIPISK AEFAVLLSAF  240
NFILPYLIGW YAFADSIKPE DSNRANSSNT RTVDHEWSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-1089627836219p24: plant transcriptional regulator PBF-2
1l3a_B1e-1089627836219p24: plant transcriptional regulator PBF-2
1l3a_C1e-1089627836219p24: plant transcriptional regulator PBF-2
1l3a_D1e-1089627836219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683246.10.0PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ9LL851e-111WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA0A2C9WM721e-118A0A2C9WM72_MANES; Uncharacterized protein
STRINGXP_010683246.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.21e-112ssDNA-binding transcriptional regulator