PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_153660_mmxf.t3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family M-type_MADS
Protein Properties Length: 387aa    MW: 43429.5 Da    PI: 6.5844
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_153660_mmxf.t3genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF702.2e-221053245
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        + en+s rq+t+skR++gilKKA+ELS+LCd++ a+++fs+ gk
  Bv6_153660_mmxf.t3 10 KLENSSSRQTTYSKRKHGILKKAQELSILCDIDLALVMFSPGGK 53
                        679*************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.408153IPR002100Transcription factor, MADS-box
SMARTSM004326.3E-28160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-24293IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-17323IPR002100Transcription factor, MADS-box
PfamPF003194.0E-201154IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MGKVKLDIKK LENSSSRQTT YSKRKHGILK KAQELSILCD IDLALVMFSP GGKPSLCCGK  60
HSSIEEVIAR LNQLPPQERT KRKLEGLEAL KKTYRKKSDH AVNIEDFLDT SAPTLKDVTE  120
QASKLQTRLA EIHERLWYWT NPDNVNDFGL LMQMEDSLEK SLDQIQRQKE NFQKQHCLAL  180
VNEENFQKEH RLALENQFSF QASGGQQLQS LLWNPSDNIQ QTFLTQEQKS HTQRDIESCT  240
GSTSGSYFGC LSTSSKSEAN SPGQLSGIDN VGHDAFQGLQ FGGMYSYLPY GLNMQGGDST  300
NMQSMLGMDQ RQSTALAYDA GRNYQSTLPS HGIGNHFLPD TPADSAFADY NNYQWQKSTV  360
QAPAMPSIYE RIAGDPSHLL FDNNPKS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683156.10.0PREDICTED: agamous-like MADS-box protein AGL30 isoform X1
SwissprotQ1PFA46e-77AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A0K9QDY11e-113A0A0K9QDY1_SPIOL; Uncharacterized protein
STRINGXP_010683156.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.27e-74AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]