PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_131110_ptmy.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family TCP
Protein Properties Length: 397aa    MW: 43267.4 Da    PI: 7.399
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_131110_ptmy.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1097.2e-341163183109
                 TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg..... 88 
                         +k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i+++tg+++++as+  +   s +++  s+g     
  Bv6_131110_ptmy.t1 116 PKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGSGTIPASALATTGASIAQQGTSIGsdlgg 206
                         6999***********************************************************9999988844444444444555557777 PP

                 TCP  89 ........................................................................................... 88 
                                                                                                                    
  Bv6_131110_ptmy.t1 207 ssrpstnwaalvgmggagtnlgiwapppphhisgfsttattttttsnsttgttttyvggvnegtnylqkigypgfdvgganlghmnygqil 297
                         7778888888888888888888998888888888888888888888888889999999999999999999999999999999999999998 PP

                 TCP  89 .....kaaksaakskksqksaasaln 109
                              +    ++ ++++q++++ +++
  Bv6_131110_ptmy.t1 298 ggnhsH---HHQ-QQQQQQQHQ-HQQ 318
                         753220...222.222222221.111 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.0E-33120326IPR005333Transcription factor, TCP
PROSITE profilePS5136928.016121175IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MDPKGRKQPP LQEEVPPATL LQPHHFLSLP HPTITASSTT LIPINMVDNS HTHNNNNNNN  60
HLSNNSIKPA EIKDFQIEIA DKQIQQHQQQ QQEEQDDQQQ PQQQQQQQKK QVQLGPKRSS  120
NKDRHTKVEG RGRRIRMPAL CAARIFQLTR ELGHKSDGET IQWLLQQAEP SIIAATGSGT  180
IPASALATTG ASIAQQGTSI GSDLGGSSRP STNWAALVGM GGAGTNLGIW APPPPHHISG  240
FSTTATTTTT TSNSTTGTTT TYVGGVNEGT NYLQKIGYPG FDVGGANLGH MNYGQILGGN  300
HSHHHQQQQQ QQQHQHQQHQ QHQQHQQLNQ SMPGLELGLS QDVHVGVLTP QALSQIYQQM  360
GHHHQSRGGQ IGSGLTSLHH QQDHQPSNSK DDSQESA
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269|PubMed:12631321, ECO:0000269|PubMed:16123132}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00636PBMTransfer from Glyma.19G095300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010679990.10.0PREDICTED: transcription factor TCP20
RefseqXP_010679991.10.0PREDICTED: transcription factor TCP20
SwissprotQ9LSD56e-66TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A0K9RNI31e-101A0A0K9RNI3_SPIOL; Uncharacterized protein
STRINGXP_010679990.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.11e-59TCP family protein
Publications ? help Back to Top
  1. Zhu P, et al.
    Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972
    [PMID:27708161]
  2. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  3. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  4. Guan P
    Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1697
    [PMID:29033968]
  5. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  6. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]
  7. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]