PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv5_115440_dggo.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family LBD
Protein Properties Length: 268aa    MW: 30733.2 Da    PI: 6.7887
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv5_115440_dggo.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.84.4e-3910108199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rrkC++ C+lapyfp +q+k f+nvhklFG+++++kllk l+++++++amss++y+A++r r PvyG+v+vi++l++q++q +
  Bv5_115440_dggo.t1  10 ACAACKYQRRKCTSTCPLAPYFPPDQHKMFQNVHKLFGVKKIQKLLKLLHPSQHNEAMSSIIYQANIRERSPVYGCVEVIQHLRNQIRQCE 100
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         +el ++++
  Bv5_115440_dggo.t1 101 EELYAVHS 108
                         **998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.2179110IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-3710106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MTLKGGNNQA CAACKYQRRK CTSTCPLAPY FPPDQHKMFQ NVHKLFGVKK IQKLLKLLHP  60
SQHNEAMSSI IYQANIRERS PVYGCVEVIQ HLRNQIRQCE EELYAVHSML NTYRHQHDHQ  120
QISTNVVSFT DINSASQLQL GMGPPSNIIP SFYNQNTAVL QQHYNSENVV PLSQNHSYSS  180
SSSPYHSSYL DVKEPLLNSM WIQHPGIHDN TNSENENAIP IQSELVITSE SPAFQENAFQ  240
DYNDMHPYFD TIDDRQSYID SKVAYDSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-3061137114LOB family transfactor Ramosa2.1
5ly0_B9e-3061137114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678608.10.0PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A2C9UJM32e-91A0A2C9UJM3_MANES; Uncharacterized protein
STRINGXP_010678608.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.18e-45LOB domain-containing protein 27