PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv5_114550_iote.t2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family M-type_MADS
Protein Properties Length: 359aa    MW: 40672.2 Da    PI: 6.1108
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv5_114550_iote.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.91.1e-22953145
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        kr e++snrqvt+skRr+gi+KKA+EL +LCd+++ +++fs+tgk
  Bv5_114550_iote.t2  9 KRLESSSNRQVTYSKRRTGIIKKAKELAILCDIDIVLLMFSPTGK 53
                        689****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.231161IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-31160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-26295IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-19323IPR002100Transcription factor, MADS-box
PfamPF003198.4E-211157IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGRVKLKIKR LESSSNRQVT YSKRRTGIIK KAKELAILCD IDIVLLMFSP TGKPTVFLGE  60
RSNLEQVITK FAQLTPQERA KRKLESLEAL KKTFKKCDHD VNIEEFVASS SQTAEELTNQ  120
MGLLQAQITE AHKRLSCWSN PDKIDNVEHL RQMENSLSES LNLIRLHKEN MGKHQLMSLD  180
CSSQFQNGMH MPLMMGSLQD CQPLSWLSSN ESQQLMLPDD SSFLPHRDMK CTTDASLSGY  240
SGYYGDVKTE IDNARQCENT GQECGTLNEL TTNACMGVQI GEQYPYSPYG NINLPEEKKL  300
MPDNNGVNFQ GNNPIDYQIA GHFDLPRSIY DTRPQPWIPT ALPCPIPMFN ENSYPEPNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A8e-14192190MEF2C
5f28_B8e-14192190MEF2C
5f28_C8e-14192190MEF2C
5f28_D8e-14192190MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019105212.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X4
SwissprotQ7X9I01e-109AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A0K9R7470.0A0A0K9R747_SPIOL; Uncharacterized protein
STRINGXP_010678493.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-111AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]