PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv5_113480_aoik.t2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family M-type_MADS
Protein Properties Length: 82aa    MW: 9388.98 Da    PI: 9.8661
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv5_113480_aoik.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.41.2e-30959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+nrqvtfskRr g+lKKA+E+S+LCda+va+iifs++gkl+ey+s
  Bv5_113480_aoik.t2  9 KRIENKINRQVTFSKRRIGLLKKAHEISILCDADVALIIFSTKGKLFEYAS 59
                        79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.637161IPR002100Transcription factor, MADS-box
SMARTSM004329.2E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.02E-28263IPR002100Transcription factor, MADS-box
CDDcd002651.01E-35259No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010154Biological Processfruit development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRIGLLK KAHEISILCD ADVALIIFST KGKLFEYASD  60
TXWIVVEIGE LKIFCLLCSC LQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A5e-21159159MEF2C
5f28_B5e-21159159MEF2C
5f28_C5e-21159159MEF2C
5f28_D5e-21159159MEF2C
6byy_A5e-21159159MEF2 CHIMERA
6byy_B5e-21159159MEF2 CHIMERA
6byy_C5e-21159159MEF2 CHIMERA
6byy_D5e-21159159MEF2 CHIMERA
6bz1_A5e-21159159MEF2 CHIMERA
6bz1_B5e-21159159MEF2 CHIMERA
6bz1_C5e-21159159MEF2 CHIMERA
6bz1_D5e-21159159MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678364.11e-36PREDICTED: truncated transcription factor CAULIFLOWER A isoform X1
RefseqXP_019105194.11e-36PREDICTED: truncated transcription factor CAULIFLOWER D isoform X2
SwissprotQ6E6S79e-34AP1_VITVI; Agamous-like MADS-box protein AP1
TrEMBLA0A0J8CFD53e-35A0A0J8CFD5_BETVU; Uncharacterized protein
STRINGXP_010678364.14e-36(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.13e-35AGAMOUS-like 8
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]