PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv4_083830_qnrf.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 246aa    MW: 27932.2 Da    PI: 5.4328
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv4_083830_qnrf.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.77.3e-1748941056
                        HHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox 10 eqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        e +++Le++Fe +++++ e++ ++A+++gL+ rqV +WFqNrRa+++
  Bv4_083830_qnrf.t1 48 EKVKALEKHFEVENKLQPERKLKIAEEVGLEPRQVAIWFQNRRARWR 94
                        56899*****************************************9 PP

2HD-ZIP_I/II112.72.4e-3641132293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         kk rl  e+vk+LE++Fe e+kL+perK ++a+e+gl+prqva+WFqnrRAR+++kqlE++y  L+++ydalk++  +Le+e+ +L ++lk
  Bv4_083830_qnrf.t1  41 KKSRLCFEKVKALEKHFEVENKLQPERKLKIAEEVGLEPRQVAIWFQNRRARWRAKQLEREYGDLRASYDALKHDYGSLEQEKIALLAQLK 131
                         9**************************************************************************************9998 PP

         HD-ZIP_I/II  93 e 93 
                         +
  Bv4_083830_qnrf.t1 132 D 132
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.9693696IPR001356Homeobox domain
SMARTSM003899.6E-1240100IPR001356Homeobox domain
CDDcd000868.41E-144197No hitNo description
SuperFamilySSF466892.78E-1642107IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-1744102IPR009057Homeodomain-like
PfamPF000463.2E-144894IPR001356Homeobox domain
PRINTSPR000319.1E-56776IPR000047Helix-turn-helix motif
PROSITE patternPS0002707194IPR017970Homeobox, conserved site
PRINTSPR000319.1E-57692IPR000047Helix-turn-helix motif
PfamPF021834.7E-1496136IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MSSKKDNCQK NKALYSEDFQ AMLERLEEED NAEHTSGQLT KKSRLCFEKV KALEKHFEVE  60
NKLQPERKLK IAEEVGLEPR QVAIWFQNRR ARWRAKQLER EYGDLRASYD ALKHDYGSLE  120
QEKIALLAQL KDLKAEIEAR NKEITSTTFS IPGSTCTVNS SNNVTNTSSS ENIPSSVITS  180
APSSCTTFDP FGMASGLDGL QLCKAYQDHL IKIEELGIHS TNNDLLGDFF SVDQAPTLHY  240
WYNSDQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675091.10.0PREDICTED: homeobox-leucine zipper protein ATHB-16
STRINGXP_010675091.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-42homeobox protein 16