PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv4_078440_wxcn.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family M-type_MADS
Protein Properties Length: 272aa    MW: 30114.7 Da    PI: 8.3231
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv4_078440_wxcn.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.99.8e-223482149
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        k+i nk  +qvtfskR+ g++KKA ELS LC+aevavi +s  gkl+ +
  Bv4_078440_wxcn.t1 34 KPITNKPSKQVTFSKRKSGLFKKAGELSSLCGAEVAVITISAAGKLFSF 82
                        6899******************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.7962686IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-272685IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.29E-2627104IPR002100Transcription factor, MADS-box
CDDcd002658.15E-302799No hitNo description
PRINTSPR004043.5E-192848IPR002100Transcription factor, MADS-box
PfamPF003191.6E-213682IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-194863IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-196384IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MAANHQESKF LVSHHEDYNL QQKKKTGKRK IEIKPITNKP SKQVTFSKRK SGLFKKAGEL  60
SSLCGAEVAV ITISAAGKLF SFGHPTPDAT INRYVKFSAR KSDDISNNNN VNVNNGINVD  120
KLSEQYKEVL GNIELEKRRT AGASSSSNGD SPRGDINSNE KLGFCWDNVP TNDLGIIELE  180
RLKVALEGLR VEVSSKIEAV HHCSSTSLFH PKLELGSCSN ENGVAQGYED FGWINNNNND  240
HVLVRDQSIQ PLLLPMNTWF GYASENYGNF SN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-1427116295MEF2C
5f28_B3e-1427116295MEF2C
5f28_C3e-1427116295MEF2C
5f28_D3e-1427116295MEF2C
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010674587.10.0PREDICTED: agamous-like MADS-box protein AGL28
TrEMBLA0A0K9Q8436e-53A0A0K9Q843_SPIOL; Uncharacterized protein
STRINGXP_010674587.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-24AGAMOUS-like 61