PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv3_066110_niai.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family TCP
Protein Properties Length: 355aa    MW: 37532.9 Da    PI: 6.89
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv3_066110_niai.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP114.51.4e-3561131373
                 TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                         ++k++++++hTkv+gR+RR+R++a caar+F+L++eLG+++d++ti WLl+ a+ ai+e+tgt++++a ++
  Bv3_066110_niai.t1  61 VRKRPSKDRHTKVEGRGRRIRMPAACAARIFQLTRELGHKSDGETIKWLLERAESAIIEATGTGTIPAIAV 131
                         79*************************************************************99999444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136926.57666120IPR017887Transcription factor TCP subgroup
PfamPF036343.6E-2966137IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0031347Biological Processregulation of defense response
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MEDEEYNSSS NNDNNSTNSG EFPADPLPPV DTSASRAIIP VPLKVEPTET VTLATPPPLV  60
VRKRPSKDRH TKVEGRGRRI RMPAACAARI FQLTRELGHK SDGETIKWLL ERAESAIIEA  120
TGTGTIPAIA VSVNGTLKIP TTPAVNGEDL GVKKRRRTNN SDFVDVTDVG VSSGVTLSSG  180
LAPIMSNTVA LGQCAAQAPG AAHAHQGLVP LWPTNFFMLP NAAGGAQQAH IWAATPVFGL  240
AARPISGFMS EMVSGRYEPS HSSSSGTSNG NALTTNNIIG NNNTSGTTTT ATQLLREFSL  300
EIYDKRELQL MSGRPINSNN SESNHQGMSQ EQQVQLQVQT GGSSSTTPPP SSQAV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00667PBMTransfer from GSVIVG01027588001Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010693449.10.0PREDICTED: transcription factor TCP19
SwissprotQ9LT892e-68TCP19_ARATH; Transcription factor TCP19
TrEMBLA0A0J8BGA30.0A0A0J8BGA3_BETVU; Uncharacterized protein
STRINGPOPTR_0015s13660.12e-74(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.22e-54TCP family protein