PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv3_065680_xwfm.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family M-type_MADS
Protein Properties Length: 323aa    MW: 37447.7 Da    PI: 7.6897
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv3_065680_xwfm.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.33.1e-161148340
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                        i  +  r++tf kR++g++KK +ELS+LC++ v++ii+
  Bv3_065680_xwfm.t1 11 IIKEKARNTTFEKRKKGLIKKGYELSILCNVPVCIIIY 48
                        55677899*****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.9E-13161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.745148IPR002100Transcription factor, MADS-box
CDDcd002661.20E-172101No hitNo description
SuperFamilySSF554559.29E-172105IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-8323IPR002100Transcription factor, MADS-box
PfamPF003199.2E-161149IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGRAKTRMEF IIKEKARNTT FEKRKKGLIK KGYELSILCN VPVCIIIYPY EQGKQSLEAQ  60
VYAFKGEFST SKNHDHPKIA REIIDRYLRV PKEDRYKGAL NLYDMFDEWK RRADQDLCKL  120
RHKNALATYP SWDPKFDGFN LDQLMELLAH LDQKIQFVSQ RIDMIKATNH NHNQNGGLVP  180
YFEPAPISNL MISSENNVDY TNVEVLNQFP MFNYPINNNN HHYHQEYCHQ VVPFNPTALP  240
EQVGGSRMDD HGGSTSNNNM MMYNMNMMGE VGPMYYDQGS GFVENVEGSS SYGAGLSMPM  300
PLQLPMLPNV SLPRKMQYHQ MFY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11225KEKARNTTFEKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010673446.10.0PREDICTED: MADS-box protein JOINTLESS-like
TrEMBLA0A0J8CM580.0A0A0J8CM58_BETVU; Uncharacterized protein
STRINGXP_010673446.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.12e-15M-type_MADS family protein