PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv2_028110_zsrh.t2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family M-type_MADS
Protein Properties Length: 108aa    MW: 12479.4 Da    PI: 8.9431
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv2_028110_zsrh.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.42.5e-30959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+ rqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+ey+s
  Bv2_028110_zsrh.t2  9 KRIENKISRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYAS 59
                        79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.674161IPR002100Transcription factor, MADS-box
CDDcd002658.18E-42280No hitNo description
SuperFamilySSF554551.31E-34288IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-32323IPR002100Transcription factor, MADS-box
PfamPF003198.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MGRGKVELKR IENKISRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLFEYAST  60
DSSMERILER YERYCYAERQ LVATDSEGQQ EIVSHLLCHH CKLQQPFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-24185183Myocyte-specific enhancer factor 2B
1tqe_Q2e-24185183Myocyte-specific enhancer factor 2B
1tqe_R2e-24185183Myocyte-specific enhancer factor 2B
1tqe_S2e-24185183Myocyte-specific enhancer factor 2B
6byy_A2e-24185183MEF2 CHIMERA
6byy_B2e-24185183MEF2 CHIMERA
6byy_C2e-24185183MEF2 CHIMERA
6byy_D2e-24185183MEF2 CHIMERA
6c9l_A2e-24185183Myocyte-specific enhancer factor 2B
6c9l_B2e-24185183Myocyte-specific enhancer factor 2B
6c9l_C2e-24185183Myocyte-specific enhancer factor 2B
6c9l_D2e-24185183Myocyte-specific enhancer factor 2B
6c9l_E2e-24185183Myocyte-specific enhancer factor 2B
6c9l_F2e-24185183Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019103651.12e-69PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotD7SMN68e-49FULL_VITVI; Agamous-like MADS-box protein FUL-L
TrEMBLA0A0K9QKC71e-55A0A0K9QKC7_SPIOL; Uncharacterized protein
STRINGXP_010666772.13e-58(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.16e-48MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]