PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_016870_oyie.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family M-type_MADS
Protein Properties Length: 322aa    MW: 36023.9 Da    PI: 9.6389
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_016870_oyie.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.42.5e-151050242
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                        +i n+s r+ t+ kR+ g+lKK  EL +LCd++++ i++s+
  Bv1_016870_oyie.t1 10 FITNDSARKATYKKRKRGLLKKMDELTTLCDVKACAILYSP 50
                        89*************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-20160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.792149IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-22294IPR002100Transcription factor, MADS-box
CDDcd002661.67E-16285No hitNo description
PRINTSPR004047.8E-7323IPR002100Transcription factor, MADS-box
PfamPF003196.1E-161051IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MTRKKVKLAF ITNDSARKAT YKKRKRGLLK KMDELTTLCD VKACAILYSP YEARPVVWPG  60
PSGARDVIAS FKRLPEMEKV KKMVSQEEFL RQRVSKAHEQ LKRQQKENRE KEMTQIMYEC  120
LTGKSIQNMS FLDLSDLGWV INQNLNEINK RIEGFEKGKS SSNVNNINTN DNNNNNNTIN  180
NNNNNSVDHC LVSGLPPYQQ GVGPGMESEV LQAQKGNFDA MQMQMMVQPW SSFMDMMGPP  240
MVFDHHQQHS HPHPHAHPHP HHGMGMGGGG LGNGLYGGAS GGASSSTSNT NSTNMVMMMG  300
QFGEYHGHGI NPALWSNAFF PK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFITNDSARKATYKKRK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019107671.11e-153PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK36e-54AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A0K9QV841e-114A0A0K9QV84_SPIOL; Uncharacterized protein
STRINGXP_010692432.19e-73(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-54AGAMOUS-like 80
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]