PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_009820_iirh.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family Whirly
Protein Properties Length: 254aa    MW: 27513.2 Da    PI: 10.4657
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_009820_iirh.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly195.57.6e-61581951138
              Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvr 91 
                         svyk+kaal+ ++v p+f++++ g +k+kr+G++ll + ++++erkydW++kq+falsatev++l+ l++ +sceffhdpa+++sn+G+vr
  Bv1_009820_iirh.t1  58 SVYKGKAALSAEPVPPKFSTVNCGGMKVKRQGFILLSFSPSVGERKYDWQRKQVFALSATEVGSLIALGPTGSCEFFHDPAMQTSNAGQVR 148
                         79***************************************************************************************** PP

              Whirly  92 kalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsll 138
                         k+l+++  +dGsG+f++lsv+ns+ k+ne+f+vPv+ aefav+r+ +
  Bv1_009820_iirh.t1 149 KSLSIRANTDGSGYFMSLSVNNSISKTNERFTVPVTSAEFAVMRTSF 195
                         ********************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.104.0E-7149215IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544472.2E-6250227IPR009044ssDNA-binding transcriptional regulator
PfamPF085368.4E-5859193IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MMKLATIFKS RGNVSGQLLN RYNATQDLFG LHASMSCAGI STVGQQSFTN DRIFAAYSVY  60
KGKAALSAEP VPPKFSTVNC GGMKVKRQGF ILLSFSPSVG ERKYDWQRKQ VFALSATEVG  120
SLIALGPTGS CEFFHDPAMQ TSNAGQVRKS LSIRANTDGS GYFMSLSVNN SISKTNERFT  180
VPVTSAEFAV MRTSFSFALP HIMGWDRLIS QLPSPNEQNS MNAGLRSSNS MKAGQRSSNP  240
MKAGPGSSNS EWDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A5e-815221110169StWhy2
3n1i_A5e-815221110169protein StWhy2
3n1j_A5e-815221110169Protein StWhy2
3n1k_A5e-815221110169protein StWhy2
3n1l_A5e-815221110169protein StWhy2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010677192.10.0PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial
SwissprotD9J0342e-83WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A0K9QDK61e-118A0A0K9QDK6_SPIOL; Uncharacterized protein
STRINGXP_010677192.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.16e-80WHIRLY 2