PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_007900_ishd.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family M-type_MADS
Protein Properties Length: 300aa    MW: 34254.6 Da    PI: 7.5819
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_007900_ishd.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.55.5e-213178249
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        +i++ ++++vtfskRr g++KKA+EL+vLC++e a++  s++gkl+ +
  Bv1_007900_ishd.t1 31 KIKDPTKKHVTFSKRRLGLFKKASELCVLCGVEMAILTSSERGKLFCF 78
                        799******************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.8432282IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-262281IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.14E-2423108IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-162444IPR002100Transcription factor, MADS-box
PfamPF003191.0E-193178IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-164459IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-165980IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MANNNNKETE DSKKGASKKR NIGRRKIPIE KIKDPTKKHV TFSKRRLGLF KKASELCVLC  60
GVEMAILTSS ERGKLFCFGH PNSDNIIHRY LNCGSCCLKE QDHEHEHKFS SMVEENNRQH  120
KEIKRKIDEK KRFADHNGSC GFWWEEASVN EMGLDELEEL KDSLMELRNN VAKKADELNV  180
QMSNIVFDHI NTDNSRSNNS GRIGNAYCVD SVCRFDTPVL GMISNNNHRV EVQSRDGDVV  240
AQSVKFTFKN EVHMTNETDM FNFAVMNQYH QVSVTEDHKG TAMIPGVVHQ QGFEFGNGNL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675367.10.0PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLA0A0K9RPZ33e-96A0A0K9RPZ3_SPIOL; Uncharacterized protein
STRINGXP_010675367.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.19e-27AGAMOUS-like 61