PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.9345s0072.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 368aa    MW: 40590.7 Da    PI: 6.5129
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.9345s0072.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.4e-10149206562
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se
  Bostr.9345s0072.1.p 149 KRAKRIIANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLSLFQRDTTGLSSE 206
                          9*****************************************9999887776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.3E-17145209IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.622147210IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.97E-10149200No hitNo description
PfamPF001701.4E-9149207IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-10149204No hitNo description
CDDcd147031.31E-21150199No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MEDPSNPKSN QSNLPQCPAL ASATSAPFRG PYHRRAHSEV QFRLPEDLDL SEPFGGFDEL  60
GSEDDLFCSY MDIEKLGSGS GSASDSAGPS APRSDNPFSA DNGGAEAGNS RPRHRHSLSV  120
DGSSTLESIE AKKAMAPDKL AELWVVDPKR AKRIIANRQS AARSKERKAR YILELERKVQ  180
TLQTEATTLS AQLSLFQRDT TGLSSENTEL KLRLQVMEQQ AKLRDALNEQ LKKEVERLKF  240
ATGEVSPADA YNLGMAHMQY QQQPQLSFFQ HHQQQTDAQN LQQMTHQFHL FQPNNNQNTN  300
TSSRPNPPTA HQLMHQATSN APAQSHSYSE AMHEDHLGRL QGLDISSCGR GSNFGRSDTI  360
SESSSTM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0967460.0AY096746.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankAY0742690.0AY074269.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010505811.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-94RF2B_ORYSJ; Transcription factor RF2b
TrEMBLO228730.0O22873_ARATH; BZIP transcription factor
STRINGAT2G40620.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.10.0bZIP family protein