PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.9345s0037.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 726aa    MW: 78581 Da    PI: 6.2234
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.9345s0037.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.95.1e-14228289162
                          XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          e++ k+  r+++NRe+A+ sRqRKk ++eeLeekv +L +  ++L  +++    e a+l+++
  Bostr.9345s0037.1.p 228 EEDEKKKARLMRNRESAQLSRQRKKHYVEELEEKVRNLHSTITDLNGKISYFMAENATLRQQ 289
                          678899*******************************************9999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.7E-17228292IPR004827Basic-leucine zipper domain
PfamPF001706.6E-12229290IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.576230290IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.06E-12232290No hitNo description
Gene3DG3DSA:1.20.5.1702.5E-17232290No hitNo description
CDDcd147045.67E-22233284No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MADPITEQPP PPAPDPNSTH PPPSDFDSIS IPPFDDHFYH SGSAQTPIGE LMSDLGFPDG  60
EFELTFDGMD DLYFPAENES FLIPVNASNQ EQFGDFTPES EGSGISGDCV VPKDADKSIT  120
TSGCCNRESP RDSDDRCSGA ERSLDLPTPL SSQGSGNCGS DVSEATNESS PKSGNVVVDQ  180
KVKVEEPATT TSITKRKKEI EEDLSDESRN SKYRRSGEDA DASAVTGEED EKKKARLMRN  240
RESAQLSRQR KKHYVEELEE KVRNLHSTIT DLNGKISYFM AENATLRQQL GGNGMCPPHH  300
PPPPMGMYPP MAPMPYPWMP CPPYMVKQQG SQVPLIPIPR LKPQNPLGTS KAKKSESKKS  360
EAKAKKVASI SFLGLLFCLF LFGALAPIVN VNYGGISGAF YGNYRSNYIT DQIYSQHRDR  420
VLDTSRSGAG TGVSNSNGMH CGRDSVRGTR KNISGTESSV PPGNGSEPLV ASLFVPRNDK  480
LVKIDGNLII NSILASEKAV ASRKASESNE RNADLVIPKD YSPALPLPDV GRTEEMAKHL  540
YRSNTEKQKA LSSGSADSLK DQFKTKAANG EMQQWFREGV AGPMFSSGMC TEVFQFDVSS  600
TSGAIIPASP ATNVSAEHGK NTTDTHKRKN RRILRGLPIP LPGSDFNLTK EHQRNSSSKE  660
IKPASSMVVS VLVDPREGGD GDIDGMIGGP KSLSRVFVVV LLDSAKYVTY SCVLPRSGAP  720
YLVTT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0004080.0BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankAY1362950.0AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881751.10.0bZIP transcription factor family protein
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLD7LGH50.0D7LGH5_ARALL; BZIP transcription factor family protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein