PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.8705s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family B3
Protein Properties Length: 396aa    MW: 45394.1 Da    PI: 10.2366
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.8705s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.81.3e-15691196
                         EEEE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                   B3  1 ffkvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89
                         ffk l     + s+ l++p  f+ ++  g +  e+kt  l++  s  +Wevk+  ++++    lt+GWkeF+ a++L+ gD+vvF+ ++++ 
  Bostr.8705s0004.1.p  6 FFKPL--LPGFYSH-LTIPVAFFLKNikGRD--EQKTAELRSdASKITWEVKI--DGQR----LTDGWKEFAVAHDLRIGDIVVFRQERDMA 86
                         56666..5566676.9******999985444..55678888758889******..9888....***********************777788 PP

                         E..EEEE CS
                   B3 90 felvvkv 96
                         f  +v++
  Bostr.8705s0004.1.p 87 F--HVTM 91
                         8..7665 PP

2B380.51.7e-25140230496
                          E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
                   B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                          + +++++l  +rl lp++f++e+g++++++ +++l++e+g+sW+v l+ +k+ g +++++GW++F++angL++g f++Fkl++r +++lv
  Bostr.8705s0004.1.p 140 ANITPSTLLYDRLNLPRSFVRENGLDTRCG-EIVLMNEKGKSWTVDLSGKKSCGNTYIKRGWRSFCHANGLRAGSFFTFKLIQR-GRTLV 227
                          56788889999***************9987.****************99999999***************************95.44456 PP

                          EEE CS
                   B3  94 vkv 96 
                          +++
  Bostr.8705s0004.1.p 228 LRL 230
                          655 PP

3B366.63.6e-21293389199
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          f++v+++ ++ +++rl lp +f++  g++  + k++++ d++g +W+ +l+ +kk++r+ l +GWkeF++an++k gD+v+++l+++ ++
  Bostr.8705s0004.1.p 293 FVTVTLTRYNVSLSRLNLPIPFTKVSGIE--KAKKMSFLDKHGVKWSTNLRSEKKRKRMRLVGGWKEFCDANRVKIGDSVMLELIWEAQK 380
                          788999*****************666766..5569***************************************************9888 PP

                          ..EEEEE-S CS
                   B3  91 elvvkvfrk 99 
                          + v+k+++k
  Bostr.8705s0004.1.p 381 SSVLKFCSK 389
                          889999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.773395IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.8E-224107IPR015300DNA-binding pseudobarrel domain
CDDcd100174.57E-14592No hitNo description
SuperFamilySSF1019365.69E-195101IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.8E-22695IPR003340B3 DNA binding domain
PfamPF023622.0E-101687IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.1E-25130231IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.94E-22135236IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.763137234IPR003340B3 DNA binding domain
CDDcd100172.69E-24137230No hitNo description
SMARTSM010192.4E-32138234IPR003340B3 DNA binding domain
PfamPF023624.3E-24139230IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.5E-23285389IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-21289389IPR015300DNA-binding pseudobarrel domain
CDDcd100177.35E-18292387No hitNo description
SMARTSM010192.6E-24293390IPR003340B3 DNA binding domain
PfamPF023621.6E-20293389IPR003340B3 DNA binding domain
PROSITE profilePS5086314.113293389IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MASQHFFKPL LPGFYSHLTI PVAFFLKNIK GRDEQKTAEL RSDASKITWE VKIDGQRLTD  60
GWKEFAVAHD LRIGDIVVFR QERDMAFHVT MLGPSCCEIQ YVSCLDDHNN LRKIQRKKRV  120
RKNPRRETES SSLDPSCFVA NITPSTLLYD RLNLPRSFVR ENGLDTRCGE IVLMNEKGKS  180
WTVDLSGKKS CGNTYIKRGW RSFCHANGLR AGSFFTFKLI QRGRTLVLRL SPKETEEEQK  240
CSEANYVESL STEQESDEES SQDEKSSQEC SKRKQKKSTS IWKASSSASQ NRFVTVTLTR  300
YNVSLSRLNL PIPFTKVSGI EKAKKMSFLD KHGVKWSTNL RSEKKRKRMR LVGGWKEFCD  360
ANRVKIGDSV MLELIWEAQK SSVLKFCSKV MPETK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010472488.10.0PREDICTED: putative B3 domain-containing protein REM15
SwissprotO230761e-129REM15_ARATH; Putative B3 domain-containing protein REM15
TrEMBLR0HTE70.0R0HTE7_9BRAS; Uncharacterized protein (Fragment)
STRINGscaffold_400948.11e-169(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.11e-125B3 family protein