PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7903s0158.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CPP
Protein Properties Length: 560aa    MW: 59827 Da    PI: 8.2814
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7903s0158.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.81.2e-14116156142
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                          ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  Bostr.7903s0158.1.p 116 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVEN 156
                          589**************************.********9875 PP

2TCR50.83.4e-16201240140
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Bostr.7903s0158.1.p 201 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 240
                          589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-16116156IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.825117241IPR005172CRC domain
PfamPF036386.9E-11118153IPR005172CRC domain
SMARTSM011141.5E-19201242IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12204239IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MGEGEAGDKF PPKKEEVTQE SKKSARQLDF TGGSDVEHSQ SNQAPVVSSS TAAASIPSPA  60
VTPTRPVTSQ VRSVVTAIPA PPQSLGLLHV PIRHPKPESP KSKPRPVGET RDGTPQKKKQ  120
CNCKHSRCLK LYCECFASGT YCDGCNCVNC FNNVENEPAR REAVESTLER NPNAFRPKIA  180
SSPHGGRDNR EEVGEVVMLG KHNKGCHCKK SGCLKKYCEC FQANILCSEN CKCLDCKNFE  240
GSEDRQSLFH GEHSHNVAYL QHANAAITGA IGSSGFASAP APKRKKGQEI FFNQGTKDSS  300
TNRLSQANSG RTTSSKTGSR AGGNASLGPS KVVYRSLLAD IIQPEDVKAL CSVLVAVAGE  360
AAKALTEKQL ADQKETSVSS SVQDQGQGNN KGTKVEKAAS GNQAEKSGPE DSNSDGSKGR  420
SLSPETLALM CDERDTMLMV AASPNCSVEP TSQLPNGQDQ VYAEQEKVVL TKFRDCLNRI  480
ISYGELKESN CSLSRMDLDT PVHSAVKIQP VVQQGPVANG VSQTTKQPSQ LTTTTTTTPN  540
TSSQIHLHKT PALSEKKDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-321082501132Protein lin-54 homolog
5fd3_B4e-321082501132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00269DAPTransfer from AT2G20110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.7903s0158.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935560.0AB493556.1 Arabidopsis thaliana At2g20110 mRNA for hypothetical protein, partial cds, clone: RAAt2g20110.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001325172.10.0Tesmin/TSO1-like CXC domain-containing protein
SwissprotQ9SL700.0TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLA0A1P8B2C50.0A0A1P8B2C5_ARATH; Tesmin/TSO1-like CXC domain-containing protein
STRINGBostr.7903s0158.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.10.0Tesmin/TSO1-like CXC domain-containing protein