PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7867s1535.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family BES1
Protein Properties Length: 315aa    MW: 33862.6 Da    PI: 8.3326
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7867s1535.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822217.62.8e-6791492145
               DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspe 91 
                          +sgr+ptwkErEnnk+RERrRRai+akiy+GLRaqGn+klpk++DnneVlkALc eAGw+vedDGttyrkg+kp+ +++  g+ ++ s++
  Bostr.7867s1535.1.p   9 SSGRTPTWKERENNKKRERRRRAITAKIYSGLRAQGNFKLPKHCDNNEVLKALCLEAGWIVEDDGTTYRKGFKPP-ASDNSGTPTNFSTN 97 
                          89*************************************************************************.9************* PP

               DUF822  92 sslqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                          ss+q s++ssa++sp++sy+ sp sssfpsps++d ++++    llp+l++ ++
  Bostr.7867s1535.1.p  98 SSIQPSPQSSAFPSPAPSYHGSPVSSSFPSPSRYDGNPSS--YLLLPFLHNIAS 149
                          *************************************987..899999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.3E-619133IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009741Biological Processresponse to brassinosteroid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MAAGGGGSSS GRTPTWKERE NNKKRERRRR AITAKIYSGL RAQGNFKLPK HCDNNEVLKA  60
LCLEAGWIVE DDGTTYRKGF KPPASDNSGT PTNFSTNSSI QPSPQSSAFP SPAPSYHGSP  120
VSSSFPSPSR YDGNPSSYLL LPFLHNIASS IPANLPPLRI SNSAPVTPPL SSPTSRGSKR  180
KLTSEQLPNG GSLHALRHPL FAISAPSSPT RRAGHQTPPT IPECDESEED SIEDSGRWIN  240
FQSTAPTSPT FNLVKQTSIA IDMTRSDWGL SGMNGRGAEF EFENGTVKPW EGEMIHEVGV  300
EDLELTLGGT KTQC*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00474DAPTransfer from AT4G36780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0973570.0AY097357.1 Arabidopsis thaliana AT4g36780/C7A10_580 mRNA, complete cds.
GenBankAY0503940.0AY050394.1 Arabidopsis thaliana AT4g36780/C7A10_580 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411962.10.0hypothetical protein EUTSA_v10025775mg
SwissprotQ94A430.0BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLV4LS330.0V4LS33_EUTSA; Uncharacterized protein
STRINGscaffold_700428.11e-175(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM115122333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36780.12e-96BES1/BZR1 homolog 2