PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7867s1419.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family Nin-like
Protein Properties Length: 342aa    MW: 39976.1 Da    PI: 10.3724
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7867s1419.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.34.1e-25212260452
               RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           +sledlskyF l+i +A+++L+v+lT+LK++CR++GI+RWP+Rkiksl
  Bostr.7867s1419.1.p 212 GLSLEDLSKYFGLTIVEASRNLNVGLTILKKKCREFGIPRWPRRKIKSL 260
                          589********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.553195280IPR003035RWP-RK domain
PfamPF020422.1E-20213260IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MAHSLTSLTI FQSVIRKEMV RSLHVYGSVE IEREFLFESK SRYVEKKAKP LFRSVDFRRP  60
EISERSVFGT WRCIFVFRFN HSLPQFPTLL CLSRNPKLED IPNLANELKF ISELKSRKPS  120
KISDQEQCSR VGYCKLDQPK PLKLVFKEDS VQDCEVDQPK PRKLVLKQDL NYLPDSETES  180
EESENDKTEH SESDAKTEML RKKRTPSKIV AGLSLEDLSK YFGLTIVEAS RNLNVGLTIL  240
KKKCREFGIP RWPRRKIKSL DSLIHDLQRE AEKQQEKNEA AAMAVAKRRK KLETEKRNIL  300
ERPFMEIHIE TKRFRQVNFK KRHRASRAKK NQETFVTSSS T*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.7867s1419.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0311359e-93AL031135.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F8D20 (ESSAII project).
GenBankAL1615879e-93AL161587.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 83.
GenBankCP0026879e-93CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010437453.10.0PREDICTED: protein RKD5-like
RefseqXP_019089344.10.0PREDICTED: protein RKD5-like
SwissprotO817910.0RKD5_ARATH; Protein RKD5
TrEMBLV4MLF60.0V4MLF6_EUTSA; Uncharacterized protein
STRINGBostr.7867s1419.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM120492429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-164RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Tedeschi F,Rizzo P,Rutten T,Altschmied L,Bäumlein H
    RWP-RK domain-containing transcription factors control cell differentiation during female gametophyte development in Arabidopsis.
    New Phytol., 2017. 213(4): p. 1909-1924
    [PMID:27870062]