PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7867s1253.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 446aa    MW: 48877 Da    PI: 9.8019
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7867s1253.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.33.8e-14365414554
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                          +r++r++kNRe+A rsR+RK+a++ eLe ++++L++ N++L+k+  e+ +
  Bostr.7867s1253.2.p 365 RRQKRMIKNRESAARSRARKQAYTMELEAEIAQLKELNEELQKKQVEIME 414
                          69*************************************99876555444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.4E-14361426IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.473363408IPR004827Basic-leucine zipper domain
CDDcd147072.32E-26365419No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-13365421No hitNo description
SuperFamilySSF579596.88E-10365417No hitNo description
PfamPF001707.4E-12365421IPR004827Basic-leucine zipper domain
PROSITE patternPS000360368383IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MGSRTNFKNF VDGLSDEAAI NPKQPMMGSS LPLTRQNSVF SLTFDEFQNS WGGGIGKDFG  60
SMNMDELLKN IWTAEESHSM MGNNTSFNNI NNGNNGNTVI NNNGGLSVGM GGESGGGFFT  120
GGSLQRQGSL TLPRTISQKT VDDVWKELMK EDDIGNSAGN GGTNGIPQRQ QTLGEMTLEE  180
FLARAGVVRE EPQPVESVNN FNGGFYGFGS NAGLGTARNG IGANQPHNFG GNGAAVRPDQ  240
LTTQTQPLHM QQPQQLIQKQ ERPFPKQTTI AFSNTVDAVN RSQPATQFQE VKPSILGIRD  300
HPMNNNLLQA VDFKTGVTVA AVSPGSQMSP DLTPKSALDA SLSPVPYMFG RVRKTGAVLE  360
KVIERRQKRM IKNRESAARS RARKQAYTME LEAEIAQLKE LNEELQKKQV EIMEKQKNQL  420
LEPLRQPWRM GCKRQCLRRT LTGPW*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00038PBMTransfer from AT4G34000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0935460.0AF093546.1 Arabidopsis thaliana clone 11 abscisic acid responsive elements-binding factor (ABRE) mRNA, complete cds.
GenBankAY0814670.0AY081467.1 Arabidopsis thaliana unknown protein (F17I5.190:F17I5.200) mRNA, complete cds.
GenBankAY0546050.0AY054605.1 Arabidopsis thaliana Unknown protein (F17I5.190:F17I5.200) mRNA, complete cds.
GenBankAK1758510.0AK175851.1 Arabidopsis thaliana mRNA for abscisic acid responsive elements-binding factor (ABRE/ABF3), complete cds, clone: RAFL22-47-B14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284949.10.0hypothetical protein CARUB_v10006251mg
SwissprotQ9M7Q30.0AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLR0F7H30.0R0F7H3_9BRAS; Uncharacterized protein
STRINGAT4G34000.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.20.0abscisic acid responsive elements-binding factor 3