PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7867s0740.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family CPP
Protein Properties Length: 597aa    MW: 63437.3 Da    PI: 8.1343
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7867s0740.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.71.3e-14126165141
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                          ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  Bostr.7867s0740.1.p 126 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 165
                          589**************************.********986 PP

2TCR50.63.7e-16211250140
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Bostr.7867s0740.1.p 211 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 250
                          589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-16126166IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.427127251IPR005172CRC domain
PfamPF036387.5E-11128163IPR005172CRC domain
SMARTSM011141.5E-19211252IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12214249IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MGEGGGGGEF PPKKDGVEEG FPAKNPARQL DFTGGSDEHS LSKVAAAPTV VATAVKPIIT  60
TTSVPSTIRP GLTVAIGQVR PTLPVVTTPI PPSQSQILNA PIRQPKPESP KARPRPIVEA  120
RDGTPQKKKQ CNCKHSRCLK LYCECFASGT YCDGCNCVNC FNNVDNEPAR REAVEATLER  180
NPFAFRPKIA SSPHGVRDKR EDIGEVVLLG KHNKGCHCKK SGCLKKYCEC FQANILCSEN  240
CKCLDCKNFE GSEERQALFH GEHANHMAYL QQAANAAITG AVGSSGFAPS PAPKRRKGQE  300
ILFNQATKDS SRLGQFPQVN SGRTSGPTSG TSPSPVSRAG GNVSSAPSKF VYRSLLADII  360
QPQDVKALCS VLVAVAGEAA KTLTDQRKEK ENRVEDQTDT SLASSAQDHS HGNKDAADVE  420
MVANGNHADK SGPEDSNSDG ADASNVKPLS PATLALMCDE QDTIFMVAAA SPNGSVDPGG  480
CGTNSQGQSE IYAEQERVVL TKFRDCLSRL ISYAELKESK CSNLARMHLQ PPATATVKTE  540
NGIQQQVPIV NGASRTTSQP TLNKPQPVQL MNTTAAAATN THHLHKPPAL SEKKDP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-3112826011132Protein lin-54 homolog
5fd3_B2e-3112826011132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.7867s0740.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186580.0AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059310.0BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285877.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLR0H2810.0R0H281_9BRAS; Uncharacterized protein
STRINGBostr.7867s0740.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein