PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7128s0552.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 473aa    MW: 52757.7 Da    PI: 5.2541
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7128s0552.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.23.2e-07157217161
                          XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                          e+e +r rr   NRe+Ar   +R++a +eeL +k++ L+ eN+ L+ e +   ke ++l++
  Bostr.7128s0552.1.p 157 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLTYENENLRREKDWALKEFQSLET 217
                          78899*****************************************998887777777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-9157221IPR004827Basic-leucine zipper domain
PfamPF001703.3E-7157219IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.036159222IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.94E-6161216No hitNo description
Gene3DG3DSA:1.20.5.1708.2E-7161227No hitNo description
CDDcd147021.36E-12167213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MDLEPISSCC SSSSSSGEDA AAANMTELEA AEALADLAQL AIMREQVFES ASSWGSKGKR  60
VRKRVKTESP PSDSLLKPPD SETLPTPDLA EERLVKEEEE EEEEEEEEVQ PIIKELTKAP  120
VKTEMNGETP KPNVASTIRC SRSNGCGRSR QNLSEAEREE RRIRRILANR ESARQTIRRR  180
QAMCEELSKK AADLTYENEN LRREKDWALK EFQSLETMNK HLKEQVSKSV KPDTKEPEEP  240
PKPSQVEMSA SSTPFYFYNQ NPYQLFCWPH VTQSSNPMIS PLEFATSGGG SAKTMTLQEH  300
ENPADDNGQK THFYVVPCPW FLPPDHSNGV PVGLQDTQRG TFSNGHHIDD SSARPLEVTK  360
TPWSHLPTRI KEEDSGSPET RPLYDLNESA TEVLSEGGEG FPVTPQAYSL KHEEDISETT  420
NGVTPMPPGH HVLISLPGKK QGSLAAAEAR KRRKELTRLK NLHGRQCRMQ VG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1449454RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0003190.0BT000319.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
GenBankAY0998750.0AY099875.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010477168.10.0PREDICTED: uncharacterized protein LOC104756295
TrEMBLR0II410.0R0II41_9BRAS; Uncharacterized protein
STRINGAT1G19490.10.0(Arabidopsis thaliana)
STRINGfgenesh1_pm.C_scaffold_10016640.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.10.0bZIP family protein