PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7128s0539.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family BES1
Protein Properties Length: 332aa    MW: 35911.9 Da    PI: 9.402
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7128s0539.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822207.43.9e-64161552144
               DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspe 91 
                          +++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqGny+lpk++DnneVlkALc eAGwvve+DGttyrkg kpl   ++agss++a+p 
  Bostr.7128s0539.2.p  16 ATRRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVEEDGTTYRKGHKPL-PGDMAGSSSRATPY 104
                          689************************************************************************.************** PP

               DUF822  92 sslqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvls 144
                          ss ++s+ ss++ sp+ sy+ sp+sssfpsps++   ++   ++++p+l++ +
  Bostr.7128s0539.2.p 105 SSHNQSPLSSTFDSPILSYQVSPSSSSFPSPSRVGDPHNI--STIFPFLRNGG 155
                          *********************************8776655..67888887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.9E-6117138IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MTSDGATSTS AAAAMATRRK PSWRERENNR RRERRRRAVA AKIYTGLRAQ GNYNLPKHCD  60
NNEVLKALCS EAGWVVEEDG TTYRKGHKPL PGDMAGSSSR ATPYSSHNQS PLSSTFDSPI  120
LSYQVSPSSS SFPSPSRVGD PHNISTIFPF LRNGGIPSSL PPLRISNSAP VTPPVSSPTS  180
KNPKPLPTWE SFTKQSMAMA AKQSMTSLNY PFCAVSAPAS PTHHRQFHAP ATIPECDESD  240
SSTVDSGHWI SFQKFSQQPF HGGSAVPASP TFNLVKPAPQ QLSPNTAATQ EIGQSSDFKF  300
ENSQVKPWEG ERIHDVAMED LELTLGNGKS S*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11736RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00073ChIP-chipTransfer from AT1G19350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0650410.0AY065041.1 Arabidopsis thaliana At1g19350/F18O14_4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010459602.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 2
RefseqXP_010459601.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 2
SwissprotQ9LN630.0BZR2_ARATH; Protein BRASSINAZOLE-RESISTANT 2
TrEMBLR0GQL60.0R0GQL6_9BRAS; Uncharacterized protein (Fragment)
STRINGAT1G19350.30.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.31e-179BES1 family protein