PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7128s0485.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family M-type_MADS
Protein Properties Length: 370aa    MW: 42505.8 Da    PI: 6.3609
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7128s0485.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF75.25.3e-24954146
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                         kr e++snrqvt++kR+ngilKKA+ELS+LCd+++ +++fs+tg+ 
  Bostr.7128s0485.1.p  9 KRLESTSNRQVTYTKRKNGILKKAKELSILCDIDIVLLMFSPTGRA 54
                         689*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.735161IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-31160IPR002100Transcription factor, MADS-box
CDDcd002662.96E-27282No hitNo description
SuperFamilySSF554551.44E-26295IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-20323IPR002100Transcription factor, MADS-box
PfamPF003193.1E-201157IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-202338IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-203859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGRVKLKIKR LESTSNRQVT YTKRKNGILK KAKELSILCD IDIVLLMFSP TGRATAFHGE  60
HSCIEEVISK FAQLTPQERT KRKLESLEAL KKTFKKLDHD VNIHDFLGAR NQTIEGLSNQ  120
VAIYQAQLME CHRRLSCWTN IDRIENTEHL NLLEESLRKS IERIQIHKEH YRKNQLLQIE  180
CTTTQFHSGI QLPMAMGGNS SMQEAHSMSW LPDNDNQQTI LPGDSSFLPH REMDGSIPVY  240
SSCFFESTKP EDQICSNPGQ QFEHLEQQGN GCLGLQQLGE EYPYPTPFGS TLGMEEDQEK  300
KIKSEMELTN LQQQQQQQDP SMYDPMANNN NGCFQIPHDQ SMFVNDHHHH QNWVPDSMFG  360
QTSYNQQPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-14192190Myocyte-specific enhancer factor 2B
1tqe_Q3e-14192190Myocyte-specific enhancer factor 2B
1tqe_R3e-14192190Myocyte-specific enhancer factor 2B
1tqe_S3e-14192190Myocyte-specific enhancer factor 2B
6c9l_A3e-14192190Myocyte-specific enhancer factor 2B
6c9l_B3e-14192190Myocyte-specific enhancer factor 2B
6c9l_C3e-14192190Myocyte-specific enhancer factor 2B
6c9l_D3e-14192190Myocyte-specific enhancer factor 2B
6c9l_E3e-14192190Myocyte-specific enhancer factor 2B
6c9l_F3e-14192190Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.7128s0485.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1431720.0AY143172.1 Arabidopsis thaliana MADS-box protein AGL65 (AGL65) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001321506.10.0AGAMOUS-like 65
SwissprotQ7X9I00.0AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLD7KH660.0D7KH66_ARALL; AGL102
STRINGBostr.7128s0485.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.10.0AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]