PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7128s0261.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 161aa    MW: 18058.7 Da    PI: 8.7967
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7128s0261.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.64.5e-43141131100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +Ca+Ck+lrrkC+kdCv+apyfpa++p kfa+vhk+FGasnv k+l++l+e++r+da++s+vyeA+ar++dPvyG+v++i++l+ qle l
  Bostr.7128s0261.1.p  14 PCAGCKLLRRKCVKDCVFAPYFPAKEPYKFAIVHKIFGASNVNKMLQELSENHRSDAVNSMVYEANARVQDPVYGCVRTISSLHVQLEAL 103
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++la +++e
  Bostr.7128s0261.1.p 104 QTQLAFAQAE 113
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.54813114IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-4114111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MRQKGHRHGR TVSPCAGCKL LRRKCVKDCV FAPYFPAKEP YKFAIVHKIF GASNVNKMLQ  60
ELSENHRSDA VNSMVYEANA RVQDPVYGCV RTISSLHVQL EALQTQLAFA QAELIHVRTL  120
YRIDTKPPPY TASTVTFPTN KDFDMAFVYE DGAGDSLWSC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-411311510112LOB family transfactor Ramosa2.1
5ly0_B4e-411311510112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.7128s0261.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cytokinin. {ECO:0000269|PubMed:17485849}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738421e-161AB473842.1 Arabidopsis thaliana ASL9 mRNA for ASYMMETRIC LEAVES2-like 9 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020869105.11e-110LOB domain-containing protein 3
RefseqXP_020869106.11e-110LOB domain-containing protein 3
RefseqXP_020869107.11e-110LOB domain-containing protein 3
RefseqXP_020869108.11e-110LOB domain-containing protein 3
RefseqXP_020869109.11e-110LOB domain-containing protein 3
RefseqXP_020869110.11e-110LOB domain-containing protein 3
RefseqXP_020869111.11e-110LOB domain-containing protein 3
RefseqXP_020869112.11e-110LOB domain-containing protein 3
RefseqXP_020869113.11e-110LOB domain-containing protein 3
RefseqXP_020869114.11e-110LOB domain-containing protein 3
SwissprotQ9SA511e-105LBD3_ARATH; LOB domain-containing protein 3
TrEMBLD7KEG51e-109D7KEG5_ARALL; Predicted protein
STRINGBostr.7128s0261.1.p1e-119(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16530.11e-108ASYMMETRIC LEAVES 2-like 9
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]