PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.6864s0265.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 187aa    MW: 21269.2 Da    PI: 9.2761
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.6864s0265.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.65.7e-1371129563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          ++ +rk +NRe+A+rsR++K++ +ee      +L+++N++Lk++l+    ++++ k+e+
  Bostr.6864s0265.1.p  71 RKKKRKLSNRESAKRSREKKQKHLEEMSIHLNQLKTQNQELKNQLQYVLHHCQQTKMEN 129
                          6899****************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-1162125No hitNo description
SMARTSM003387.5E-1467131IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.86469132IPR004827Basic-leucine zipper domain
PfamPF001702.4E-1071129IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.88E-971122No hitNo description
CDDcd147027.28E-1972123No hitNo description
PROSITE patternPS0003607489IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MMSTISPVFS SEPGLATFVP AFETGFTPWD ISHLFPVFDS SLDPIPSSAH DYGSVNRTSS  60
DVAPTENTDE RKKKRKLSNR ESAKRSREKK QKHLEEMSIH LNQLKTQNQE LKNQLQYVLH  120
HCQQTKMEND RLRLEHRILQ DKLLNIRQVL MFPQIGRSSN CATWPCVNST VVTVQQNPSI  180
IIGTPL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16976ERKKKRKL
27091RKKKRKLSNRESAKRSREKKQK
37176KKKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010503643.11e-109PREDICTED: ocs element-binding factor 1-like
TrEMBLD7LSY01e-106D7LSY0_ARALL; BZIP transcription factor family protein
STRINGscaffold_501993.11e-106(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.17e-93basic leucine-zipper 5