PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.6864s0195.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 112aa    MW: 12926.2 Da    PI: 4.7238
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.6864s0195.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26081.31.5e-25498397
               DUF260  3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94
                         +aCk  r kC ++Cv+ py+ a++p+k+an+  +F  s + k+l ++++++r++ +++l++ Aear+rdPv G++g+i  lq+qle l+  l
  Bostr.6864s0195.1.p  4 CACKDARHKCIEECVFVPYLLANKPEKYANLSTVFDISFLAKFLMDIEPSQRQTCVDTLCFDAEARLRDPVMGSTGLICLLQRQLEDLELLL 95
                         48************************************************************************************998766 PP

               DUF260 95 all 97
                         + +
  Bostr.6864s0195.1.p 96 KIA 98
                         665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.8791102IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-26597IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MEPCACKDAR HKCIEECVFV PYLLANKPEK YANLSTVFDI SFLAKFLMDI EPSQRQTCVD  60
TLCFDAEARL RDPVMGSTGL ICLLQRQLED LELLLKIAKR DYMVILQEIH EQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-24310311112LOB family transfactor Ramosa2.1
5ly0_B8e-24310311112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.6864s0195.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019101899.16e-44PREDICTED: LOB domain-containing protein 6-like
TrEMBLR0H7D01e-43R0H7D0_9BRAS; Uncharacterized protein
STRINGBostr.6864s0195.1.p4e-77(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-22LBD family protein