PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.6864s0194.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 127aa    MW: 14597 Da    PI: 8.7246
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.6864s0194.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260108.64.8e-3420108189
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                          +Ca+Ck+lrr+C++dC++apy+  ++++++a vhk+ G+s+v  +++++++++re+amssl +eA+ r++dPvyG++ +i +lq+ql+ 
  Bostr.6864s0194.1.p  20 PCAVCKYLRRRCTRDCIFAPYLSTNKQENYALVHKVIGVSHVATMINEIHPSQREIAMSSLSWEAQTRLNDPVYGCTIIIDRLQRQLKV 108
                          7*************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.96919120IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-3320108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
LTLYTNIQIL LYQMDKITPP CAVCKYLRRR CTRDCIFAPY LSTNKQENYA LVHKVIGVSH  60
VATMINEIHP SQREIAMSSL SWEAQTRLND PVYGCTIIID RLQRQLKVIN HFYIVHGNSL  120
DNNAIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-31201061197LOB family transfactor Ramosa2.1
5ly0_B6e-31201061197LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.6864s0194.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292643.21e-49LOB domain-containing protein 28
SwissprotQ9SCS43e-41LBD28_ARATH; LOB domain-containing protein 28
TrEMBLR0FSZ02e-49R0FSZ0_9BRAS; Uncharacterized protein (Fragment)
STRINGBostr.6864s0194.1.p3e-90(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50510.11e-43LOB domain-containing protein 28