PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.6864s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 195aa    MW: 21867.4 Da    PI: 6.8915
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.6864s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1322.6e-1059104550
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                           + +r   NReA r++R++K a+++ Le++vk L++ N+ L  +l+
  Bostr.6864s0050.1.p  59 SNKKRSFGNREAVRKYREKKNARTAYLEDEVKRLQSLNEHLLRKLQ 104
                          67899999*********************************98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-1051120No hitNo description
SMARTSM003381.2E-754122IPR004827Basic-leucine zipper domain
PfamPF077163.6E-1455104IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.65757123IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.13E-758105No hitNo description
CDDcd146861.12E-967105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042538Biological Processhyperosmotic salinity response
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MNMDKKEVEV WDRASRGCSH THSCNPPGPD DASHSHTCFH THTHLIIPDQ QENDHSDSSN  60
KKRSFGNREA VRKYREKKNA RTAYLEDEVK RLQSLNEHLL RKLQSQIMVE TEFIRLRTLL  120
GEMQGKIDGE LGGFSNQKQC TGSGFVFKED GCSVATSKIL CEAARVECED GQTLHDAAIH  180
SCVSSFTTIL TLSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0054221e-175BT005422.1 Arabidopsis thaliana clone U50385 putative bZIP family transcription factor (At3g51960) mRNA, complete cds.
GenBankAK1176291e-175AK117629.1 Arabidopsis thaliana At3g51960 mRNA for putative bZip transcription factor Atbzip24, complete cds, clone: RAFL17-28-M01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010515641.11e-117PREDICTED: uncharacterized protein LOC104791444 isoform X2
SwissprotQ8GTS11e-100BZP24_ARATH; Basic leucine zipper 24
TrEMBLR0FRK31e-111R0FRK3_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__1547__AT3G51960.21e-103(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM151721518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51960.12e-89basic leucine zipper 24