PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.5763s0039.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 284aa    MW: 31143.4 Da    PI: 5.397
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.5763s0039.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_160.24.2e-19126175352
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                          +lkr rr+ +NRe+ArrsR+RK++++ eLe kv++L++eN++L k+l   
  Bostr.5763s0039.1.p 126 DLKRMRRMHSNRESARRSRRRKQEYLVELESKVDSLKGENSTLYKQLIDA 175
                          79*****************************************9887555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.5E-14119178No hitNo description
SMARTSM003381.1E-15124188IPR004827Basic-leucine zipper domain
PfamPF001705.0E-17126172IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.45126172IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.25E-13127178No hitNo description
PROSITE patternPS000360131146IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MDGYTAKDMG MKTSASELAL QEYLTKVLSS SALSRQESIL DTSPLDPSFD LIDRDYTSEL  60
RDSLLWSESL IPTGPFRDAQ SSICANNPEA RGGTRRTTSG SSHYHSDEED AETEAGQSEM  120
TNDPNDLKRM RRMHSNRESA RRSRRRKQEY LVELESKVDS LKGENSTLYK QLIDATQQFL  180
SAGTNNRVLK SDVETLRVKV KLAEDLVARG SLTSSLNQLL QSHLSPPPHS INSLHYTGNT  240
SPAITVHSDQ SLFPGMTLSG QTSSPGLGNV SSEAVSCVSD IWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140147RRSRRRKQ
2142147SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2268730.0AK226873.1 Arabidopsis thaliana mRNA for bZIP protein BZO2H2, clone: RAFL09-07-B02.
GenBankAF3102230.0AF310223.1 Arabidopsis thaliana bZIP protein BZO2H2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010454805.11e-179PREDICTED: basic leucine zipper 9
SwissprotQ9FUD31e-172BZIP9_ARATH; Basic leucine zipper 9
TrEMBLR0GW391e-176R0GW39_9BRAS; Uncharacterized protein
STRINGAT5G24800.11e-169(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63702641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.11e-136basic leucine zipper 9