PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.5022s0146.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GeBP
Protein Properties Length: 415aa    MW: 45366 Da    PI: 4.7723
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.5022s0146.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573127.65.3e-40195287297
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          +fqr+w+e+Deiv+LqGl+d+k++tg+sp+dd++++y+ +kksisf+vsk q++eK+r+LK+K+ +k k+   g+ep+f k+hd+k+fel
  Bostr.5022s0146.1.p 195 YFQRVWTEDDEIVVLQGLMDYKNDTGVSPYDDTNGVYQLLKKSISFDVSKVQFMEKLRNLKNKYVGKAKN---GEEPTFVKPHDRKAFEL 281
                          79*****************************************************************999...***************** PP

               DUF573  92 skkiWg 97 
                          sk +Wg
  Bostr.5022s0146.1.p 282 SKLVWG 287
                          *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.8E-31196287IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MSSKRVNPQE DPPTTSSSDE DEVDTSSAEK DDVSSKNPAA LKNTVVVLAA PTGKQVSDSD  60
SGSEEESDED EVDTSSEEED DVSSKNPAAL KNTVAVLAAP TGKQVSDSDS GSEEESDSDS  120
EPEKKDQVLT KPVTETKDSA VKNLDSKKVK TSEKSVGKRS RETDEGVSTD VKRVKKGSGE  180
DEKKSGGGKE TKKTYFQRVW TEDDEIVVLQ GLMDYKNDTG VSPYDDTNGV YQLLKKSISF  240
DVSKVQFMEK LRNLKNKYVG KAKNGEEPTF VKPHDRKAFE LSKLVWGANG MALESAVKSN  300
GKSSKKSSKS KKVESVKQEL DSSLPNGKNC EDEVTNKVEV SVLGDPSLVK SLARFGVDEL  360
AAQQGLIRLA SEDKKRFEEQ WKALQVREFE FYSQKSGFIH EVVTKIAEAF RSNI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010492929.11e-162PREDICTED: mediator-associated protein 1-like
TrEMBLR0I1M21e-142R0I1M2_9BRAS; Uncharacterized protein
STRINGAT1G11510.11e-120(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.11e-93DNA-binding storekeeper protein-related transcriptional regulator