PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.5022s0114.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 521aa    MW: 56630.9 Da    PI: 9.9102
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.5022s0114.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.71.9e-11372430563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          kr +r   NR++A rs +RK  +++eLe kv++L++e ++L  +l +l+  +  l++++
  Bostr.5022s0114.1.p 372 KRVKRILANRVSAARSKERKTRYMAELEHKVQTLQTEATTLSAQLTHLQRDSMGLTNQN 430
                          899*********************************************99888777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.8E-19368432IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.749370433IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.83E-11372428No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-9372429No hitNo description
PfamPF001701.1E-9372429IPR004827Basic-leucine zipper domain
CDDcd147031.41E-20373422No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0010628Biological Processpositive regulation of gene expression
GO:0010629Biological Processnegative regulation of gene expression
GO:0090567Biological Processreproductive shoot system development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MGGGTDTNMM QRVNSSSGTS SSSIPKQISP NLHLNPALIR SQQQFRQPFT GAPPPIPPVS  60
PYSQIPATLQ PRHSRSMSQP SSYFSFDSLP PLKPSPQPVS VSVEEKNGAG FSPSLPPSPF  120
TMRHSSSSRN AGDGDNLPPR KSHRRSNSDV TFGFSSMMVQ NQKSPPLVPS RSLERSISGG  180
EVSDWSNLVK EEPKEGFFKA RKSEGEAAMD DVFTAYMNLD NIDVLNSFGG EDGKNGNENV  240
EEMESSRGSG TKKTNGGSSS DSEGESSASG NVKVAVSSSS GVKRRAGGDI APTTRHYRSV  300
SMDSCFMGKL NFGDESSLKL PPSSAKVSPT NSGEGNSSAY SVEFGNSEFT AAEMKKIAAD  360
EKLAEIVMAD PKRVKRILAN RVSAARSKER KTRYMAELEH KVQTLQTEAT TLSAQLTHLQ  420
RDSMGLTNQN SELKFRLQAM EQQARLRDAL SEKLTEEVQR LKLVIGEPNR RQSSSSESNI  480
SKTSLNPEMF QQLSISQLQH QQMQHSKQNS TMKAKHTSNE *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00037PBMTransfer from AT2G21230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0932680.0AY093268.1 Arabidopsis thaliana putative bZIP transcription factor (At2g21230) mRNA, complete cds.
GenBankAY0544970.0AY054497.1 Arabidopsis thaliana putative bZIP transcription factor (At2g21230; F7O24.5) mRNA, complete cds.
GenBankAF4012980.0AF401298.1 Arabidopsis thaliana transcription factor bZIP30 (BZIP30) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880366.10.0hypothetical protein ARALYDRAFT_480978
TrEMBLD7LL150.0D7LL15_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.4__38__AT2G21230.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156251417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.10.0bZIP family protein