PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.5022s0113.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 578aa    MW: 63641.2 Da    PI: 8.6315
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.5022s0113.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.11.6e-12402455457
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                           kr rr   NReAA rs qRK +++  Le +v++L+ eN+++  ++  l+k   
  Bostr.5022s0113.1.p 402 PKRVRRILANREAAARSKQRKSQYVVFLEHRVDTLQYENTSMSRTITVLEKDKM 455
                          5999******************************************99998755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-16399463IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.254401464IPR004827Basic-leucine zipper domain
PfamPF001702.3E-11403460IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-12403456No hitNo description
SuperFamilySSF579593.75E-11403458No hitNo description
CDDcd147031.06E-17404453No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MNGHGNMTPL STQYQNPSGN DGGKRTGVLP FPITPASPYS QVPPLTRYPA GSPHFSPGPR  60
CTNLPSPTFS YLPQTSPSST SFHTSLPPVY PSPSSSRRDS LPPKYPSPSS SRRDSLPPVC  120
PSPSSSRRDS FPHFNPGPRS VTQLAPVFSS LPLSAVYSSL PPVTPSLSSV RRNSLPPMYP  180
SPSAHVENRD SSIGFNRNPS PLPPRVPVTR SNSMSASGSN TLPPRKSHKR TDGDIIGINT  240
TIPLNPPESS YPPPSDLLVG ESSCDKEGVV EWTYDKKARK EFFNEFMILD NTNNDANGNE  300
TVDDVMITFS NSDENGFKTG PTTSGVKRRA GKDIDPSTRH YESVPMDSSF NDMLKPSPSP  360
GNLPVDGTEN SFSFKLGNGE YNSSELKKIA GSTRLTQVAA DPKRVRRILA NREAAARSKQ  420
RKSQYVVFLE HRVDTLQYEN TSMSRTITVL EKDKMMMMNE NKEMKIRVES LEKEGQLREA  480
LTEQLCAEIL RLKVTTVLNG QESVDAQRLK DAIALNEQLC AEIERLKVAA GEVMQNHGQF  540
DGSNMQPLDP NMFQQLNINQ FNQFNQPQPN FDFYGQN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1415423ARSKQRKSQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880367.11e-119hypothetical protein ARALYDRAFT_900536
TrEMBLD7LL161e-119D7LL16_ARALL; Putative uncharacterized protein
STRINGscaffold_400037.11e-119(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-53bZIP family protein