PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.5022s0106.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GeBP
Protein Properties Length: 300aa    MW: 32970.4 Da    PI: 8.9467
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.5022s0106.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57350.55.8e-16153191240
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyef 40 
                          lfqr+wseeDeivlLq++idf+++tgks+++d+++f + 
  Bostr.5022s0106.1.p 153 LFQRVWSEEDEIVLLQAMIDFRSNTGKSVYEDMNNFLKR 191
                          69**********************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.7E-10154191IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MAKKNQSQHL VTPSTVKKPL KVASTSKKPA KKLSEVVSTA KNKKQPEPMK IPPPESSSDE  60
EEEDEPSNEV APSPSASAPV VAVTATESSD SVSESETENE SDSETEPATT KTPLPAASAP  120
VVAITSIQSS APSTEVSKRS KTERGTETAK NALFQRVWSE EDEIVLLQAM IDFRSNTGKS  180
VYEDMNNFLK RNKYVGYWKT CVEPSFTKPH DKKCWELAKI IWPTDVDKKK IKVENDIGGA  240
KYVKEVWRSV PVKAKKKVEE KWKSLKANEL QGILIKSELL KEVSSLIAKE VSSPIPKSD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002868656.15e-51hypothetical protein ARALYDRAFT_916208
TrEMBLD7MJ895e-51D7MJ89_ARALL; Putative uncharacterized protein
STRINGscaffold_703950.11e-50(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00610.18e-21DNA-binding storekeeper protein-related transcriptional regulator