PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.3288s0094.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family Nin-like
Protein Properties Length: 299aa    MW: 33981.2 Da    PI: 6.2781
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.3288s0094.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.32e-25133182352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          + +s+e++s+yF+++i++AA eL+v+lT+LKr+CR++GI+RWPhRk+ sl
  Bostr.3288s0094.1.p 133 NALSMETVSRYFYMSITQAAMELNVGLTLLKRRCRELGIRRWPHRKLMSL 182
                          789********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.847104203IPR003035RWP-RK domain
PfamPF020421.1E-20135182IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MADHKTKEEK PFSFLTQSPS FDHSSLTYPL LDWEEDLLAL HESSASQAFP LTTTSLPLPD  60
LEPLSEDVLN SYSSASWNET EQNRGDGASS EKKTEYGAVQ ETTKKRKINE RRREHSVRII  120
SDITTYTTYP ASNALSMETV SRYFYMSITQ AAMELNVGLT LLKRRCRELG IRRWPHRKLM  180
SLKTLISNVK ELQKMEGEEN AEKLQNALEM LEKEKRMIEE LPDLEFEDKT KRLRQACFKA  240
NHKRKKKRNL KSDQSQIPSC SNSGSVASDG SVNEAGMESD EEVKYLLCGF SSEFSSGL*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00234DAPTransfer from AT1G74480Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.3288s0094.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0565180.0DQ056518.1 Arabidopsis thaliana RWP-RK domain-containing protein (At1g74480) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010428433.10.0PREDICTED: protein RKD2
SwissprotQ9CA661e-176RKD2_ARATH; Protein RKD2
TrEMBLR0GEJ61e-176R0GEJ6_9BRAS; Uncharacterized protein
STRINGBostr.3288s0094.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39662356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.11e-162RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Tedeschi F,Rizzo P,Rutten T,Altschmied L,Bäumlein H
    RWP-RK domain-containing transcription factors control cell differentiation during female gametophyte development in Arabidopsis.
    New Phytol., 2017. 213(4): p. 1909-1924
    [PMID:27870062]