PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.3148s0051.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 319aa    MW: 34727.9 Da    PI: 5.0623
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.3148s0051.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.44.7e-16234290258
                          XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                          ++ +r+rr++kNRe+A rsR+RK+a++ eLe  +++Le+eN+ L+ke+ee +ke ++
  Bostr.3148s0051.1.p 234 AAAQRQRRMIKNRESAARSRERKQAYQVELEALAAKLEEENELLAKEIEEKRKERYQ 290
                          5789**********************************************9999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.6E-13231288No hitNo description
SMARTSM003388.6E-11233297IPR004827Basic-leucine zipper domain
PfamPF001709.4E-15234293IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.254235287IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-9237289No hitNo description
CDDcd147073.37E-19237283No hitNo description
PROSITE patternPS000360240255IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MASFQVMPSS NSRNSDLAHR ISSSSSASLS IRPQQQFTQD LTSGGYGGRN DGLYSSTSMT  60
VEGILHDTFA SDPPAPTESS LLDASITLMD ASPAPMEITK TTVVPDVIDH GGGGGGGGGG  120
TETTREGRTV DEVWREMVSG EGKGMKEETQ EEIMTLEDFL AKAAVTAEDL DVKIPPTNYG  180
FDHSAPPHNP FQMIDKVEGS IVAFGNGLDV YGGGGGGGAR GKRARVMVEP LDKAAAQRQR  240
RMIKNRESAA RSRERKQAYQ VELEALAAKL EEENELLAKE IEEKRKERYQ RLMEFVIPVV  300
EKPQQPPRFL RRIRSLEW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0864570.0AY086457.1 Arabidopsis thaliana clone 25211 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199221.10.0basic leucine zipper transcription factor
SwissprotP427771e-69GBF4_ARATH; G-box-binding factor 4
TrEMBLQ8LCQ70.0Q8LCQ7_ARATH; Putative uncharacterized protein
STRINGAT5G44080.11e-180(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.11e-147bZIP family protein