PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.30057s0084.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 373aa    MW: 41982 Da    PI: 9.8028
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.30057s0084.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.98.8e-082412831759
                           HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                           A+rsR RK+++i eLe+ v++L+ae ++   el+ l++    l
  Bostr.30057s0084.1.p 241 AQRSRVRKLQYISELERNVQTLQAEGSKVSAELDFLNQRNLIL 283
                           89*******************************9999876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0052230289IPR004827Basic-leucine zipper domain
CDDcd147035.89E-15233280No hitNo description
SuperFamilySSF579597.5E-6241283No hitNo description
Gene3DG3DSA:1.20.5.1702.9E-5241281No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MTSSKGSQSV KNLMYPGKHA LLPPKIPFPS VSASYSEYIP SGLIGSRHGQ KLGDEKTHHQ  60
RTSSESHLVE ELPFWLDDLL NEPESPARKC GHRRSSSDSY AYLDVANATN ISLTLQNDFS  120
YRNTVSSTQR GMQELDRNKI AQDAAFYSDA NFLKQKSRQR DSLVVSGARP SWLPFSRESA  180
GGKNMGSSYM SQEATVISER KNCAEPLSHD PKMFSSEKNN SNPPPVTYEA DNTKRAKQQF  240
AQRSRVRKLQ YISELERNVQ TLQAEGSKVS AELDFLNQRN LILSMENKAL KQRLESIAQE  300
KLIKQLEQKV LEKEIGRLRV LYQQQQQTQK PSASHGRATS KDLESQFSNL SLNTKDSNCR  360
LDSVSVMGQF HF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0039800.0BT003980.1 Arabidopsis thaliana clone RAFL15-22-D03 (R20596) putative bZIP family transcription factor (At1g58110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002888232.10.0predicted protein
SwissprotQ8W3M79e-62Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLD7KY870.0D7KY87_ARALL; Predicted protein
STRINGAl_scaffold_0002_6820.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33602444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.20.0bZIP family protein