PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2983s0195.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 413aa    MW: 45446.2 Da    PI: 5.0803
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2983s0195.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.42e-15214268357
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                          ++k+ rr+ +NRe+ArrsR+RK++++  Le+ v eL++e ++L k+l++++ +++
  Bostr.2983s0195.1.p 214 DVKKSRRMLSNRESARRSRRRKQEQTSDLETQVNELKGEHSSLLKQLSNMNHKYD 268
                          789*****************************************99999888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-19212276IPR004827Basic-leucine zipper domain
PfamPF001701.7E-14214268IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.243214269IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.29E-11215267No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-12216267No hitNo description
PROSITE patternPS000360219234IPR004827Basic-leucine zipper domain
PfamPF124989.1E-13283376IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002240Biological Processresponse to molecule of oomycetes origin
GO:0009626Biological Processplant-type hypersensitive response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MNSIFSIDDF SDPFWETPPI PLNPDSAKSQ VSQSQPEWTF EMFLEEISSS PVSSEPLGNN  60
NAIVGVSSAQ SLPSVSGQND FEDDSRFRDR DSGNWDCAAP LTNVVVDSDD YHRVLKNKLE  120
TECATVVALR VGSVKPEDST SSPETQFQPA QSSPLTQGSL VAPVEVGVTS SLPAELKKTG  180
VPMKQVTSGS SREYSDDDDL DEENETTGSL NPEDVKKSRR MLSNRESARR SRRRKQEQTS  240
DLETQVNELK GEHSSLLKQL SNMNHKYDEA AVGNRILKAD IETLRAKVKM AEETVKRVTG  300
MNPMLLGRSN GHNNNRMPLT GNNRMDSSSI IPAFQPHSNL NHMSNPNVGI PTILPPRLGN  360
NFVPPPSLNS QTNSPLQRIR NGQNHHVAPN ANPYGWTTEP QNDSAWPKKC VD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1228235RRSRRRKQ
2230235SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0255580.0BT025558.1 Arabidopsis thaliana At4g02640 mRNA, complete cds.
GenBankAF3102220.0AF310222.1 Arabidopsis thaliana bZIP protein BZO2H1 mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286506.10.0hypothetical protein CARUB_v10001050mg
SwissprotO227630.0BZP10_ARATH; Basic leucine zipper 10
TrEMBLR0GRA40.0R0GRA4_9BRAS; Uncharacterized protein
STRINGAT4G02640.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148711720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02640.20.0bZIP family protein