PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.29827s0269.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family bZIP
Protein Properties Length: 164aa    MW: 17760.5 Da    PI: 10.0375
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.29827s0269.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.43.5e-1484144161
                           XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                           +ke kr +r+ +NR++A+  R+RKka++  Le+kvk L + N++L +++++l++e + l+ 
  Bostr.29827s0269.2.p  84 DKENKRLKRLLRNRVSAQQARERKKAYLNDLEKKVKDLGSTNSELEEKVSTLQNENQMLRH 144
                           5899***************************************************998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.3E-1584148IPR004827Basic-leucine zipper domain
PfamPF001708.8E-1385145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.28986149IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-1488146No hitNo description
Gene3DG3DSA:1.20.5.1704.1E-1888148No hitNo description
CDDcd147041.73E-1789140No hitNo description
PROSITE patternPS00036091106IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MQEQATSSLA ASSLPSSSER SSSSAPPLEI KEGIESDEEI SRVPEFGGEV TGNETYGGRN  60
SASVVGQEQV QATGQRKRGK SSADKENKRL KRLLRNRVSA QQARERKKAY LNDLEKKVKD  120
LGSTNSELEE KVSTLQNENQ MLRHILKNTT ANKRGGGGSN PES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A2e-14109148342Transcription factor HY5
2oqq_B2e-14109148342Transcription factor HY5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394793.17e-75hypothetical protein EUTSA_v10004860mg
SwissprotO246467e-67HY5_ARATH; Transcription factor HY5
TrEMBLV4KLI97e-75V4KLI9_EUTSA; Uncharacterized protein
STRINGscaffold_601144.13e-68(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.18e-54bZIP family protein