PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.29827s0158.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family M-type_MADS
Protein Properties Length: 341aa    MW: 39524.9 Da    PI: 6.6773
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.29827s0158.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.23.3e-16948342
                          --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                          i n+s r++tf kR++g++KK +EL +LC+++++ +i+s+
  Bostr.29827s0158.1.p  9 IANESSRKITFMKRKKGMMKKLHELTTLCGVQACAVIYSP 48
                          89************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.713147IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-7121IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-19158IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.94E-21292IPR002100Transcription factor, MADS-box
CDDcd002665.03E-19283No hitNo description
PfamPF003191.9E-16948IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-72136IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MRKLKLSLIA NESSRKITFM KRKKGMMKKL HELTTLCGVQ ACAVIYSPYL SAPEAWPSKE  60
GAEEVVSKFM EMPMTARAKK MMNQETYLRE MIAKVKDQVD KLALENRELQ VRQFMFDCLE  120
GKMSEYRYGA KDLHDLQWYI DHYIDQLTRR IQILAQNGES SSFPPPLPVG VADAAAVSAA  180
ASGFYDHIQY QNMNMNQTHQ QETIQHHVPI NSYDIIQYRN MDMNQNQQEP VQYQTPTDLY  240
DHIQQGNYNN MTWNDQDMNL DLNHNLNLNL HLNSNQYMNQ QQSFMGMMME QHMGGHASIP  300
FMDGNHNYNY HQRPIVDLTV STHMPSVTTG VYAPYINYNL *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11429RKITFMKRKKGMMKKL
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.29827s0158.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010493922.11e-144PREDICTED: agamous-like MADS-box protein AGL36
SwissprotQ7XJK61e-111AGL36_ARATH; Agamous-like MADS-box protein AGL36
TrEMBLR0H4001e-134R0H400_9BRAS; Uncharacterized protein
STRINGBostr.29827s0158.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26650.11e-97AGAMOUS-like 36
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]