PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.29246s0022.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 194aa    MW: 21510.4 Da    PI: 7.1342
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.29246s0022.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.62.5e-4481071100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da++slv+eA+ar+rdPvyG+vg i+ lq+q++q
  Bostr.29246s0022.1.p   8 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVHQRADAVNSLVFEANARVRDPVYGCVGAISYLQNQVSQ 96 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+ +la++++e
  Bostr.29246s0022.1.p  97 LQMQLAVAQAE 107
                           ******99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9367108IPR004883Lateral organ boundaries, LOB
PfamPF031958.8E-448105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MGGPGSSPCA SCKLLRRRCA KDCIFAPYFP SDDPHKFAIV HKVFGASNVS KMLQELPVHQ  60
RADAVNSLVF EANARVRDPV YGCVGAISYL QNQVSQLQMQ LAVAQAEILC IQMQNEPTLQ  120
SHHQVLELDQ DHKALLLHNN NNNINNCSNN NNNNLGYAMS SGQYSNFASP SSIMQMQMQM  180
QMQDPLKQES LWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4841186124LOB family transfactor Ramosa2.1
5ly0_B2e-4841186124LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.29246s0022.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1643060.0AB164306.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like gene 5 protein, partial cds.
GenBankAB4738380.0AB473838.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like 5 protein, complete cds.
GenBankAY0869600.0AY086960.1 Arabidopsis thaliana clone 29970 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565695.11e-112Lateral organ boundaries (LOB) domain family protein
SwissprotQ8LBW31e-114LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A178VRK11e-111A0A178VRK1_ARATH; PCK1
STRINGBostr.29246s0022.1.p1e-142(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-114LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]