PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.29044s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family B3
Protein Properties Length: 529aa    MW: 60423.4 Da    PI: 10.0572
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.29044s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.11.4e-1224941594
                          -EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                    B3 15 rlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                           + +p  f +++  g ++ +     l++  s   W++k+  ++++    ltkGW++F+ a+ L++gD++vF+++g+    l++
  Bostr.29044s0120.1.p 24 YILIPEAFYSNYleGRQEGN--AAELRSdASEIIWKIKM--DGRR----LTKGWEQFAVAHSLQVGDILVFRHEGN----LLF 94
                          4789*****99996555444..5666554999*******..9998....***********************7663....333 PP

2B355.41.1e-17423511394
                           EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                    B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                            v+++ ++l+++rl+lp +  +++ ++k+ + ++ l++++gr+W++ l+y+k+sg++ ++ GWk+F+ka g k g +++Fkl++++++ 
  Bostr.29044s0120.1.p 423 VVFVTVSNLREDRLYLPVRLSRSNILDKKIH-EINLMNKEGRTWTLCLKYSKSSGKFSISHGWKSFCKAIGQKPGCTFLFKLVRNRTG- 509
                           678999******************7777675.9*************************************************998776. PP

                           .EE CS
                    B3  92 lvv 94 
                            +v
  Bostr.29044s0120.1.p 510 -HV 511
                           .33 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.0E-186104IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-176104IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.32110102IPR003340B3 DNA binding domain
CDDcd100175.52E-131199No hitNo description
SMARTSM010192.3E-1613102IPR003340B3 DNA binding domain
PfamPF023622.9E-82493IPR003340B3 DNA binding domain
PROSITE profilePS508636.245194243IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-7292379IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-8297377IPR015300DNA-binding pseudobarrel domain
SMARTSM010195.8E-7298383IPR003340B3 DNA binding domain
SuperFamilySSF1019362.55E-17417512IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.7E-17417513IPR015300DNA-binding pseudobarrel domain
CDDcd100171.21E-13421508No hitNo description
PROSITE profilePS5086313.324421517IPR003340B3 DNA binding domain
SMARTSM010191.0E-20422517IPR003340B3 DNA binding domain
PfamPF023621.3E-16422511IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MANSISSSAK PHFFKPILPG FNTYILIPEA FYSNYLEGRQ EGNAAELRSD ASEIIWKIKM  60
DGRRLTKGWE QFAVAHSLQV GDILVFRHEG NLLFHVTPFG LSCCEILYSQ KDEKDVKDKT  120
GKLNSLPFFR VKDFTVFQLR KKEAIDVYLW SASDSGKLTR NRTVKKTAKN ECSSVDTDFV  180
VPVTSSNQRL DSFLSYHKST NRFCASRGWR AFCCRNGHKT GCFLRLILVR SGNTLALRIF  240
PLERDADSIG KHSKKINQEV EHESAKEETN LESGKLIRDR LVKKDPKNLC SSSHDTNFVV  300
PVTASNQRLD SFHLPKGFTT SIGLCKLCKE IIFIDEKGRS SILDLRRGWR AFCCRNWHKT  360
GSFLRLILVR NGKTPVLRIS PLERDEDRIE KHSKKINQEV EHESAKEEKD VESLSFSDNI  420
SFVVFVTVSN LREDRLYLPV RLSRSNILDK KIHEINLMNK EGRTWTLCLK YSKSSGKFSI  480
SHGWKSFCKA IGQKPGCTFL FKLVRNRTGH VVLMNSLEEN IHQSKTGL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026881e-101CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAB0464321e-101AB046432.1 Arabidopsis thaliana DNA, chromosome 5 centromere region, clone:F22D12.
GenBankF18O91e-101AF296831.1 Arabidopsis thaliana BAC F18O9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283509.10.0hypothetical protein CARUB_v10004562mg
SwissprotF4KFT60.0REML3_ARATH; B3 domain-containing protein REM-like 3
TrEMBLR0F3W10.0R0F3W1_9BRAS; Uncharacterized protein
STRINGAT5G32460.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17423910
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G32460.10.0B3 family protein