PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.28625s0323.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 289aa    MW: 32923.8 Da    PI: 5.9514
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.28625s0323.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601284.2e-40561551100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           aCaaCk++rrkCa+dC lapyfp++++++f n+hklFG+sn++k++k+l + e+++am++++++++ara+dPv G++g+i+klq q+e 
  Bostr.28625s0323.1.p  56 ACAACKYQRRKCARDCLLAPYFPHDRHRQFLNAHKLFGVSNITKIIKSLTPPEKDAAMHTIMFQSDARANDPVDGCYGIIRKLQYQIEY 144
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           +++el+ + ++
  Bostr.28625s0323.1.p 145 TRNELEIVLQQ 155
                           *****998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.44455156IPR004883Lateral organ boundaries, LOB
PfamPF031958.4E-3756152IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MDVHEQKKLV ADEEEKAGLK TGRPPSVFPL NPKPTPLKPS SSTSNTSNCN NSTNQACAAC  60
KYQRRKCARD CLLAPYFPHD RHRQFLNAHK LFGVSNITKI IKSLTPPEKD AAMHTIMFQS  120
DARANDPVDG CYGIIRKLQY QIEYTRNELE IVLQQLAMFR DRAHHHHQET QIQMQEPEDL  180
SSFSSSCDLN NNSSIPYNYP LNHVQEPNQQ QQYCSSGNNF NGLQEEMWCL QLQDSSTTVN  240
MTAGFIDECE DIKPVEEVSS ERHEFEPREA FVEQRKLDLP SSQFIISS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-25521597114LOB family transfactor Ramosa2.1
5ly0_B2e-25521597114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.28625s0323.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2373280.0AC237328.1 Arabidopsis lyrata clone JGIFAFI-41L7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298101.11e-178LOB domain-containing protein 22
RefseqXP_023642605.11e-178LOB domain-containing protein 22
SwissprotQ9LRW11e-173LBD22_ARATH; LOB domain-containing protein 22
TrEMBLR0HMS11e-177R0HMS1_9BRAS; Uncharacterized protein
STRINGBostr.28625s0323.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-164LOB domain-containing protein 22
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]