PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.28243s0041.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GeBP
Protein Properties Length: 202aa    MW: 23112 Da    PI: 9.9379
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.28243s0041.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57337.47.2e-12921365197
                DUF573  51 ksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                            +q+++Kir LK+K+ +k+kk     e+sf+++h +++f++sk iW+
  Bostr.28243s0041.1.p  92 PRQFTSKIRCLKDKYVRKRKK--GAAEKSFANAHVHNCFKISKVIWE 136
                           57*******************..888999*****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.6E-882136IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MAKKNKRSRP ENNHSKPENK RLKPEEDPST VKRRLQLLED PPTKKRSPQL LENLLTESSG  60
DDEEEGQESG SSSEEEGQES GSSSEEEEQK DPRQFTSKIR CLKDKYVRKR KKGAAEKSFA  120
NAHVHNCFKI SKVIWESTKV GDWFVNSSLV GAIARFGIGE DVMKQRWSMV SMKTKKKLEN  180
KFKLLQDEAS EYLSLRRSFF A*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104110KYVRKRK
2107111RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002894546.18e-45hypothetical protein ARALYDRAFT_892618
TrEMBLD7KN549e-45D7KN54_ARALL; Putative uncharacterized protein
STRINGscaffold_105412.13e-44(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01370.11e-34DNA-binding storekeeper protein-related transcriptional regulator