PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.27991s0074.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 237aa    MW: 25924.3 Da    PI: 5.0857
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.27991s0074.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.88e-43541531100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+da++s+vyeA ar+rdPvyG++g i +lq+q+++
  Bostr.27991s0074.1.p  54 PCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRTDAVNSMVYEAGARIRDPVYGCAGAIYHLQRQVSE 142
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+a+la+++ e
  Bostr.27991s0074.1.p 143 LQAQLAKTQVE 153
                           ******99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.33253154IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4254151IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MLKMEINGGV ATPTASAVAV TAVKETTTPV SSPSPTSSPP SPKQPPQTPV VLSPCAACKI  60
LRRRCAEKCV LAPYFPPTDP AKFTIAHRVF GASNIIKFLQ ELPESQRTDA VNSMVYEAGA  120
RIRDPVYGCA GAIYHLQRQV SELQAQLAKT QVELVGMQLQ RSSLLELIYK MEQTKLSAQE  180
QGQHKMSFES SFESGDEFIS SPDEESNDLG FLEDSNNNNN NINNNSSMSW WDPLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-42461553112LOB family transfactor Ramosa2.1
5ly0_B3e-42461553112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.27991s0074.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738400.0AB473840.1 Arabidopsis thaliana ASL7 mRNA for ASYMMETRIC LEAVES2-like 7 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180417.21e-137LOB domain-containing protein 11
SwissprotQ9SK081e-138LBD11_ARATH; LOB domain-containing protein 11
TrEMBLR0FXT91e-135R0FXT9_9BRAS; Uncharacterized protein
STRINGBostr.27991s0074.1.p1e-177(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-109LOB domain-containing protein 11