PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.27991s0037.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family Dof
Protein Properties Length: 337aa    MW: 36123.8 Da    PI: 9.7516
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.27991s0037.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.31.7e-3892149562
                zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           alkcprCds+ntkfCy+nny+l+qPr+fCkaCrryWt+GGalrnvPvGg++r+nkk +
  Bostr.27991s0037.1.p  92 ALKCPRCDSANTKFCYFNNYNLTQPRHFCKACRRYWTRGGALRNVPVGGSCRRNKKGK 149
                           789***************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-3674144IPR003851Zinc finger, Dof-type
PfamPF027011.8E-3292147IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.41393147IPR003851Zinc finger, Dof-type
PROSITE patternPS01361095131IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MVFSSSSFLD PPINWPQSTN SNNHPHHFQL QENGSLVSGH HQVLSHHFPQ NPNPNPHHVD  60
TAAAATVDLG SVNGQAAERA RLAKNSQPLE GALKCPRCDS ANTKFCYFNN YNLTQPRHFC  120
KACRRYWTRG GALRNVPVGG SCRRNKKGKS GNSKSSSSSS QNKQSTSMVN ATSPTTNSNV  180
QLQTNSQFPF LPTLQNLTQL GGIGLNLAAI NGNNGGNGNT SSSFLNDLGF FHGGNTSGPV  240
MGNNNNENNI MTSLGSASNF ALFDRTMGDY NFPNEGNMGL STARVSQTAP VKMEEPHMGN  300
ISRPVLGLTS LGNQSNQYWT GTGLPGSSSN HHQHLM*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.27991s0037.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0328770.0BT032877.1 Arabidopsis thaliana unknown protein (At2g28810) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850126.10.0Dof-type zinc finger DNA-binding family protein
SwissprotQ9ZV330.0DOF22_ARATH; Dof zinc finger protein DOF2.2
TrEMBLA0A178VZ400.0A0A178VZ40_ARATH; Uncharacterized protein
STRINGBostr.27991s0037.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.11e-165Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]