PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.27895s0126.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 278aa    MW: 30549.5 Da    PI: 4.5318
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.27895s0126.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.52e-4251041100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrrkC+++Cv+apyfp ++p+kf +vh++FGasnv+k+l++lp+++re++++sl+yeAear+rdP+yG+vg+i+ lqq  ++
  Bostr.27895s0126.1.p   5 PCAACKLLRRKCTQECVFAPYFPPTNPQKFICVHRVFGASNVTKILNDLPPDQREATVNSLFYEAEARIRDPIYGCVGLISFLQQYHKK 93 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           ++++l+++kee
  Bostr.27895s0126.1.p  94 VQQDLVTAKEE 104
                           ******99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381555.6E-1052277IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089126.7194105IPR004883Lateral organ boundaries, LOB
PfamPF031957.4E-415102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MASTPCAACK LLRRKCTQEC VFAPYFPPTN PQKFICVHRV FGASNVTKIL NDLPPDQREA  60
TVNSLFYEAE ARIRDPIYGC VGLISFLQQY HKKVQQDLVT AKEELAGYMG PDAVLPPPYL  120
PPLGNNPPPN FMMSMEGMPP GLIPQGEPLM IREPNFSQQH QPQDEQLQFI ASDAQRMAAM  180
ILDRGDQQGM FNGYGIDNNG SVTATGYNQT DVNDHGAGGS LSGPSLSLGS FGDPYQMGQE  240
TEHGHINHDQ LQTQLMLQPP LQEGQEQTEE GQFLMPP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-4421088114LOB family transfactor Ramosa2.1
5ly0_B5e-4421088114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBostr.27895s0126.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738350.0AB473835.1 Arabidopsis thaliana ASL2 mRNA for ASYMMETRIC LEAVES2-like 2 protein, complete cds.
GenBankAC0030400.0AC003040.3 Arabidopsis thaliana chromosome 2 clone F26B6 map CIC06C07, complete sequence.
GenBankAC0044820.0AC004482.3 Arabidopsis thaliana chromosome 2 clone F27L4 map CIC06C07, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880519.10.0LOB domain-containing protein 10
RefseqXP_020883060.10.0LOB domain-containing protein 10
SwissprotO648361e-177LBD10_ARATH; LOB domain-containing protein 10
TrEMBLD7LG100.0D7LG10_ARALL; LOB domain family protein
STRINGBostr.27895s0126.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149081720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23660.21e-141LOB domain-containing protein 10
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]